Aug 17, 1993 - signals for cell wall anchoring in Gram-positive bacteria ...... Saleem Khan, Joseph Patti and Dan Portnoy for sending us strains. Research.
The EMBO Journal vol. 1 2 no. 1 2 pp.4803 - 4811, 1993
Cell wall sorting signals in surface proteins of Gram-positive bacteria
Olaf Schneewind2, Diana Mihaylova-Petkov and Peter Model1 Department of Microbiology and Immunology, UCLA School of Medicine, Los Angeles, CA 90024 and 'The Rockefeller University, New York, NY 10021, USA 2Corresponding author Communicated by D.I.Meyer
Staphylococcal protein A is anchored to the cell wall, a unique cellular compartment of Gram-positive bacteria. The sorting signal sufficient for cell wail anchoring consists of an LPXTG motif, a C-terminal hydrophobic domain and a charged tail. Homologous sequences are found in many surface proteins of Gram-positive bacteria and we explored the universality of these sequences to serve as cell wall sorting signals. We show that several signals are able to anchor fusion proteins to the staphylococcal cell wall. Some signals do not sort effectively, but acquire sorting activity once the spacing between the LPXTG motif and the charged tail has been increased to span the same length as in protein A. Thus, signals for cell wall anchoring in Gram-positive bacteria are as universal as signal (leader) sequences. Key words: cell wall anchoring/Gram-positive bacteria/ protein sortingIStaphylococcus aureus/surface proteins
Introduction All cells are structured into compartments which fulfill specific biological functions. Such compartmentalization requires the correct sorting, maintenance and turnover of proteins (Blobel, 1980). Proteins are sorted to their subcellular destination by means of the protein export pathway, and their sorting signals, encoded within the primary structure, are recognized by specific receptors or enzymes (Pryer et al., 1992). Some sorting signals may be decoded in an unfolded state during membrane translocation (Gennity and Inouye, 1991), whereas others are presumed to have mostly secondary or even tertiary structure when they interact with their receptor (Baranski et al., 1990; Collawn et al., 1990). The molecular design of the signal and receptor may provide insight into the specific sorting process within the cell. For example, the sorting signals of proteins resident in the endoplasmic reticulum need to be permanently present because these proteins would otherwise be exported (Pelham et al., 1988; Jackson et al., 1993). This requirement does not apply to proteins which are chemically modified by proteolytic cleavage (Gottschalk et al., 1989), glycosyl-phosphatidylinositol (GPI) linkage (Brown and Rose, 1992), prenylation or carboxyl-methylation upon sorting (Gutierrez et al., 1989). It is the chemical modification that directs these molecules into, or maintains them in, their proper location within the cell. Examples of proteins modified upon sorting include enzymes directed to
the lysosome (Lobel et al., 1989), GPI anchored proteins located in specific membrane compartments (Brown and Rose, 1992), and surface proteins anchored to the cell wall of Gram-positive bacteria (Schneewind et al., 1992). Staphylococcal protein A is a model system for cell wall sorting in Gram-positive bacteria and is well known for its immunoglobulin binding properties on the cell surface (Moks et al., 1986). Protein A is thought to be covalently anchored to the peptidoglycan (Sjoquist et al., 1972b), which is corroborated by data presented here. Proper sorting of protein A to this specific location requires an N-terminal leader peptide for export across the cytoplasmic membrane and a 35 residue sorting signal at the C-terminus. This cell wall sorting signal consists of an LPXTG motif, a C-terminal hydrophobic domain and a charged tail (Schneewind et al., 1992). Many surface proteins of different Gram-positive species have homologous sequences in which the LPXTG motif is conserved, but the C-terminal hydrophobic domain and the charged tail are variable in sequence and length. Previous work left unresolved whether or not the leader peptide of protein A is required for a specific sorting function other than protein export (Schneewind et al., 1992). This question is addressed here and we show that enterotoxin B, a protein normally secreted into the medium (Tweten and landolo, 1983), can be anchored to the cell wail by Cterminal fusion with the protein A sorting signal. We demonstrate that many, but not all, sorting signals from different bacterial species are able to anchor fusion proteins to the staphylococcal cell wall. Those signals that do not sort effectively can gain sorting function if the spacing between the LPXTG motif and the charged tail is increased to 31 residues. The specific signal which is recognized 31 residues from the LPXTG motif consists of at least two positively charged amino acids. We propose that cell wall sorting of surface proteins is universal in Gram-positive bacteria and that many aspects of this sorting mechanism may be evolutionarily conserved.
Results Cell wall linkage of protein A The staphylococcal cell wall is composed of a repeating
disaccharide, N-acetylglucosaminyl-N-acetylmuramic acid, polymerized in (3-1,4 linkage (Ghuysen and Strominger, 1963). This glycan strand is linked by an amide bond of its lactyl to the N-terminus of the wall peptide, L-alanyl-Disoglutamyl-L-lysyl-D-alanine (Tipper et al., 1965, 1967; Munoz et al., 1966). The e-amino group of lysine links the wall peptide to the pentaglycine cross-bridge, which is in turn cross-linked to the D-alanine residue of another wall peptide (Strominger and Ghuysen, 1967). The staphylococcal peptidoglycan is a highly cross-linked structure that can be enzymatically solubilized with lysostaphin (Schindler and Schuhardt, 1964), an endopeptidase specific for the pentaglycine cross-bridges, or with muramidases which 4803
O.Schneewind, D.Mihaylova-Petkov and P.Model
or Hash-muramidase, and proteins were immunoprecipitated with protein A-specific antiserum. The muramidase-released protein A species formed a ladder of distinct bands, all of which migrated more slowly on SDS -PAGE than the lysostaphin-solubilized counterpart, which appeared as a single band (lanes 1 and 2, Figure 1A). When the muramidase-released protein A molecules were re-digested with lysostaphin, their migration on SDS -PAGE was identical to that of protein A directly solubilized with lysostaphin. As a control, lysostaphin re-digestion after immunoprecipitation of the lysostaphin-released material did not alter the migration of protein A on SDS -PAGE (lanes 3 and 4, Figure IA). The reciprocal experiment, re-digestion of lysostaphin-released protein A with muramidase, also did not affect its migration on SDS -PAGE (data not shown). We concluded from these experiments that the size difference between the muramidase and lysostaphin-released forms of protein A was due to linked peptidoglycan components, since its molecular substrate was lysostaphin sensitive. These findings confirmed the earlier observation that protein A is covalently linked to the staphylococcal cell wall (Sjoquist et al., 1972b).
Fig. 1. Enzymatic release of protein A from the staphylococcal cell wall. (A) Staphylococcus aureus 8325-4 was pulse labeled for 1 min with [35S]methionine and chased with non-radioactive amino acids for 5 min. After TCA precipitation, the samples were digested with either Chalaropsis B muramidase (lanes 1 and 3) or lysostaphin (lanes 2 and 4) and again precipitated with TCA. Proteins were solubilized in hot SDS and immunoprecipitated with protein A specific antiserum. The immunocomplexes were washed several times and either mock treated (lanes 1 and 2) or digested with lysostaphin (lanes 3 and 4) and finally subjected to 10% SDS-PAGE and fluorography. Molecular weight markers (kDa) are indicated. (B) Structure of the cell wall of Saureus [modified after Strominger and Ghuysen (1967)]. Arrows indicate the cleavage sites for lysostaphin and muramidase.
hydrolyze the 3-1,4 linkage of N-acetylmuramic acid and N-acetylglucosamine (Ghuysen, 1968) (Figure 1). Previous work demonstrated that protein A could be solubilized from the cell wall with either lysostaphin or, very inefficiently, with the muramidase lysozyme (Sjoquist et al., 1972a,b; Guss et al., 1984). Lysozyme released different sized protein A species that contained N-acetylmuramic acid, N-acetylglucosamine and the amino acid constituents of the wall peptide in equimolar amounts. Further digestion of these protein A species with lysostaphin resulted in the release of short wall peptides, identified by amino acid analysis of chromatography peaks. When we treated the staphylococcal cell wall with lysozyme, only 1 % of the total amount of lysostaphin-released molecules were solubilized (data not shown). Lysozyme is relatively inactive on the staphylococcal peptidoglycan due to N,6-0 diacetylation of its N-acetylmuramic acid, as well as to the presence of negatively charged teichoic acid (Brumfitt et al., 1958). In contrast to lysozyme, Chalaropsis B muramidase quantitatively cleaves the N,6-0 diacetylated staphylococcal peptidoglycan (Hash et al., 1964; Hash and Rothlauf, 1967). In order to re-examine the cell wall anchoring of protein A with the effective Hash-muramidase, Staphylococcus aureus 8325-4 cultures were pulse labeled with [35S]methionine and chased with non-radioactive amino acids. The peptidoglycan was digested with either lysostaphin 4804
Cell wall sorting of enterotoxin B fusions Previous experiments demonstrated cell wall anchoring of chimeric proteins with Escherichia coli alkaline phosphatase (PhoA) fused to the protein A leader peptide and C-terminal cell wall sorting signal (Schneewind et al., 1992). In order to determine if the leader peptide of protein A contributed any specific sorting information, we employed enterotoxin B, a protein normally secreted into the staphylococcal medium. The genes coding for either enterotoxin B (SEB) or its fusion proteins were cloned and expressed from plasmids in S.aureus OS2 (Figure 2). The cellular location of SEB proteins was investigated with three different assays. (i) Cell fractionation-staphylococci were pulse labeled with [35S]methionine and fractionated into four cellular compartments: medium (MD), cell wall (CW), cytoplasm (C) and membrane (M) (Figure 2B). (ii) Solubility in hot SDS-in a parallel experiment, pulse labeled cultures were precipitated with trichloroacetic acid (TCA) in duplicate. One of the two pulse-chase samples was digested with lysostaphin prior to boiling in hot SDS (L), whereas the other sample was directly boiled in hot SDS (CH). Secreted proteins are directly soluble in hot SDS, whereas the total cellular proteins of S.aureus are soluble in hot SDS only after cell wall digestion (Figure 2B). (iii) Cell wall linkage of proteins-the peptidoglycan of pulse labeled staphylococci was solubilized with either lysostaphin (L) or Hashmuramidase (H). Proteins were immunoprecipitated from the digests and subjected to SDS -PAGE. After digestion with muramidase, cell wall-anchored proteins migrate more slowly on SDS-PAGE than their lysostaphin-solubilized counterparts (Figure 2C). Wild-type SEB was immunoprecipitated mostly from the medium (MD), and the protein was soluble in both the lysostaphin-treated (L) and untreated (CH) samples of the pulse-chase assay. Digestion of the peptidoglycan with either lysostaphin (L) or Hash-muramidase (H) did not affect its migration on SDS-PAGE (1, Figure 2). A hybrid protein, SEB -SPA459-524, with a C-terminal fusion of protein A sequences, containing the LPXTG motif, the Cterminal hydrophobic domain and the charged tail as well
Cell wall sorting signals
A
SEB \ '..
1
\Y
SEB-SPA459-524 2
E
S E B-S PA 49
0)- 5 2 4
3
4
P
SEB-SPA496-524 77 L\\. .
0
R
SE B-A CTA
5
B
!MD
CW
C
CH
M
1
2 3 4
5
C1
IL
2
3
4
HI IL HI1 IL H1 IL H
-
Fig. 2. Cell wall sorting of enterotoxin B fusions. (A) The map displays constructs of enterotoxin B (SEB, stippled bar) with its Nterminal leader peptide (1). Hybrids with a C-terminal fusion of protein A sequences to SEB: (2) upstream protein A sequences (empty bar), the LPXTG motif (LPETG), the C-terminal hydrophobic domain (black bar) and the charged tail (RRREL); (3) lacking upstream sequences; (4) lacking upstream sequences and the LPXTG motif. A hybrid protein was designed with a C-terminal fusion of the stop-transfer segment of L.monocytogenes ACTA to SEB (5). (B) Staphylococcus aureus OS2 expressing genes of various hybrid proteins [SEB (1), SEB-SPA459-524 (2), SEB-SPA490_524 (3), SEB-SPA496-524 (4) and SEB-ACTA (5)] was pulse labeled with [35S]methionine for 1 min and chased with non-radioactive amino acids for 5 min. The culture was fractionated into medium (MD), cell wall (CW), cytoplasm (C) and membrane (M) compartments. In parallel, 1 ml of culture was pulse labeled and chased, and 500 Al each precipitated with TCA. One of these samples was lysostaphin digested (L) prior to boiling in hot SDS, whereas the other sample (CH) was directly boiled in hot SDS. Proteins were solubilized in hot SDS, immunoprecipitated with anti-SEB and subjected to 12% SDS-PAGE. (C) One milliliter of Saureus OS2 culture expressing genes of SEB proteins was pulse labeled with [35S]methionine for 1 min, chased with non-radioactive amino acids and 500 A1 each precipitated with TCA. The two samples were digested with either lysostaphin (L) or Chalaropsis B muramidase, Hash-enzyme (H) and precipitated with TCA. Proteins were solubilized in hot SDS, immunoprecipitated with anti-SEB and subjected to 12% SDS-PAGE. Molecular weight markers are indicated (kDa).
as 30 upstream residues, was found in the cell wall compartment, and it was soluble in hot SDS only after the peptidoglycan was degraded (2, Figure 2). Digestion of the cell wall with Hash-muramidase released several species of the fusion protein that migrated as a ladder of distinct bands on SDS-PAGE, significantly more slowly than the lysostaphin-solubilized counterpart (2, Figure 2C). We concluded that SEB-SPA459-524, like protein A, was covalently anchored to the staphylococcal cell wall. Deletion of protein A sequences upstream from the LPXTG motif in another fusion protein, SEB-SPA490-524, did not affect cell wall anchoring (3, Figure 2). When the LPXTG motif was absent (SEB -SPA496 524), the fusion protein was found in the cell wall, cytoplasm and membrane (4, Figure 2). This hybrid protein was soluble in hot SDS only after cell wall degradation, and digestion with either Hash-muramidase or lysostaphin did not alter its mobility on SDS-PAGE. The SEB-SPA496-524 protein migrated as two distinct bands on SDS -PAGE. The faster moving form was immunoprecipitated from the cellular fractions in larger amounts than from the pulse-chase samples, suggesting that its appearance may be due to proteolysis during the fractionation procedure. The data indicated that SEB-SPA496-524 was not linked to the peptidoglycan, but missorted within the cell. We sought to distinguish cellular locations such as cell wall sorting, missorting and secretion from membrane anchoring of exported proteins. Towards this end, we designed a chimeric protein, SEB-ACTA (5, Figure 2), in which the C-terminus of SEB is fused to the proposed stop-transfer segment of Listeria monocytogenes ACTA surface protein (Kocks et al., 1992). This hybrid protein was detected predominantly in the membrane compartment and it was insoluble in hot SDS unless the peptidoglycan was degraded (Figure 2B). As a measure for membrane anchoring, SEB -ACTA resisted alkaline extraction and pelleted with the membranes, but remained soluble after treatment with 1 % Triton X-100 (data not shown, see Materials and methods). When we compared the molecular sizes of all five SEB proteins, we noted that the cell wall-anchored SEB-SPA490_524 (3, Figure 2) migrated faster on SDS - PAGE than its unanchored counterparts, SEB-SPA496-524 and SEB-ACTA. This is consistent with the hypothesis that cell wall sorting is accompanied by proteolytic cleavage of the polypeptide chain at its C-terminus (Pancholi and Fischetti, 1988; Schneewind et al., 1992). Fusion proteins that were not anchored to the cell wall, SEB-SPA496-524 and SEB-ACTA, migrated more slowly on SDS-PAGE than wild-type SEB with a difference (2-3 kDa) that can be explained by their predicted molecular size. The migration of another anchored protein, SEB-SPA459-524, was consistent with its larger size as well as with its proteolytic cleavage at the C-terminus.
Cell wall sorting signals in different surface proteins More than 50 surface proteins of Gram-positive bacteria have predicted C-terminal sequences that display homology with the protein A cell wall sorting signal. We investigated whether or not these sequences could anchor fusion proteins to the staphylococcal cell wall. Ten such sorting signals from different bacterial species were fused to the C-terminus of two indicator proteins, enterotoxin B (SEB) and protein A
4805
O.Schneewind, D.Mihaylova-Petkov and P.Model Table I. Cell wall sorting signals in surface proteins of Gram-positive bacteria
Protein
Cell wall sorting signal
Bacterial species
SPA FNBP SPAA PRGB TEE INLA FIM. BAC CNA WAP EMM
LPETGEENPFI GTTVFGGLSLALGAALLAGRRREL LPETGGEESTNKGMLFGGLFSI LGLALLRRNKKNHKA L P AT GDS S NAYL P L L GL VS L T AGF S L L GL RRKQD LPKTGEKQNVLLTVVGS LAAMLGLAGLGF-KRRKETK LPSTGSI GTYLFKAI GSAAMI GAI GI YI VKRRKA LPTTGDSDNALYLLLGLLAVGTAMALTKKARASK LPLTGANGVI FLTI AGALLVAGGAVVAYANKRRHVAKH LPYTGVASNLVLEI MGLLGLI GTSFI AMKRRKS LPKTGMKIITSWITWVFIGILGLYLILRKRFNS LPSTGEQAGLLLTTVGLVI VAVAGVYFYRTRR
Saureus Saureus S.sobrinus
E.faecalis Spyogenes L.monocytogenes A.viscosus
S.agalactiae S.aureus Smutans
Spyogenes
LPSTGETANPFFTAAALTVMATAGVAAVVKRKEEN
Cellular topology and cell wall linkage of hybrid proteins
Signal
SPA FNBP SPAA PRGB TEE INLA FIM BAC CNA WAP EMM
SEB fusionsb
SPA fusionsa
Topologyc
%SDS-solubled%
Cell wall sortinge
Topology
%SDS-soluble%
Cell wall sorting
cell wall cell wall cell wall cell wall cell wall cell wall missortedf missorted membrane missorted secreted
0 0 0 0 0 0 5 0 0 30 80
100 100 100 100 100 100 0 0 0 0 0
cell wall cell wall cell wall cell wall cell wall membrane membrane missorted membrane ndg nd
0 0 0 0 0 0 0 0 0 nd nd
100 100 100 50 60 0 0 0 0 nd nd
Fusions to the C-terminus of protein A truncated for its own sorting signal (SPA, position 485 of the predicted polypeptide chain). Fusions to the C-terminus of enterotoxin B (SEB, position 266 of the predicted polypeptide chain). Determined by fractionation of staphylococci into the four compartments: medium, cell wall, cytoplasm and membrane. Percentage of hybrid protein directly soluble in hot SDS as compared with its solubility after cell wall degradation with lysostaphin. Percentage of muramidase-released hybrid protein that migrated more slow on SDS-PAGE than its lysostaphin-solubilized counterpart. f Hybrid protein found in all cellular compartments. g Not determined: plasmids were not stably maintained in S.aureus.
a
b c d e
(SPA) C-terminally truncated for its own sorting signal (Table I). The genes for the hybrid proteins were cloned and expressed from plasmids in S.aureus OS2, and their cellular topology was examined with the assays described above. We considered hybrid proteins to be anchored to the cell wall if they fulfilled three operational criteria: (i) location in the cell wall compartment; (ii) insolubility in hot SDS unless the peptidoglycan is degraded; (iii) slower migration on SDS -PAGE of muramidase-released protein as compared with the lysostaphin species. The latter is the most sensitive of all three criteria, as it can only be fulfilled by proteins linked to the peptidoglycan. The results obtained from these experiments are summarized in Table I. As a control, the protein A sorting signal (SPA) anchored both indicator proteins to the staphylococcal cell wall. Five other sorting signals, S.aureus FNBP (Signas et al., 1989), Streptococcus sobrinus SPAA (Tokuda et al., 1991), Enterococcus faecalis PRGB (Kao et al., 1991), Streptococcus pyogenes TEE (Schneewind et al., 1990) and L.monocytogenes INLA (Gaillard et al., 1991), also anchored fusion proteins to the cell wall. The PRGB, TEE and INLA sorting signals had different effects on cell wall sorting of the two indicator molecules. The protein A fusions were anchored to the cell wall, but the enterotoxin B fusions SEB -PRGB and SEB-TEE were only partially cell wall linked. The
4806
SEB -INLA hybrid was not sorted to the cell wall and was found in the membrane compartment. Five signals did not display cell wall sorting activity: Actinomyces viscosus FIM (Yeung and Cisar, 1990), Streptococcus agalactiae BAC (Heden et al., 1991), S. aureus CNA (Patti et al., 1992), Streptococcus mutans WAP (Ferretti et al., 1989) and Streptococcus pyogenes EMM (Hollingshead et al., 1986). Some hybrid proteins were missorted and found in all cellular compartments: SPA-FIM, SPA-BAC, SEB-BAC, SPA-WAP. Other fusion proteins were either located in the cytoplasmic membrane (SEB-FIM, SPA-CNA, SEB-CNA) or secreted into the medium (SPA-EMM). Plasmids in which SEB was fused to the EMM and WAP sorting signals were unstable in S. aureus OS2. Deletions of the seb gene were repeatedly isolated, suggesting that the hybrid proteins may be toxic for staphylococci. The cna gene is present in S.aureus FDA574 (Switalski et al., 1993), a strain isolated from bone and connective tissue infections, but not in strains 8325-4, RN4220 and OS2 (data not shown). We therefore examined if the CNA sorting signal anchored fusion proteins to the cell wall of its normal host. Since S.aureus FDA574 expressed protein A, but not enterotoxin B, this strain was transformed with several SEB plasmids. The cellular topologies of the SEB proteins were
Cell wall sorting signals
similar to those found for S.aureus OS2: SEB was secreted into the medium, SEB-SPA and SEB-FNBP were cell wall anchored, and SEB-CNA as well as SEB-ACTA were located in the membrane (data not shown). The surface exposure of protein A hybrids was investigated with the binding of FITC-labeled immunoglobulin and viewed under UV light microscopy. A protein A hybrid with a C-terminal fusion of the stop -transfer segment of coliphage fl pIlI (Davis et al., 1985), SPA-PImi, served as a control for a membrane-anchored protein in this experiment (data not shown, see Materials and methods). Membrane anchored fusion proteins, SPA-PIiI and SPA -CNA, bound FITC-labeled immunoglobulin to the staphylococcal surface in a way that was indistinguishable from the binding to the cell wall-anchored species (SPA, SPA -FNBP, SPA SPAA, SPA -PRGB, SPA -TEE, SPA-INLA). Little, but nevertheless, significant binding of FITC-labeled immunoglobulin was detected with the SPA-FIM, SPA-BAC, SPA-WAP and SPA-EMM hybrid proteins (data not shown). -
The retention signal encoded by the charged tail Mutations in the protein A charged tail result in the secretion of mutant proteins, whereas mutations in the LPXTG motif lead to molecules that are retained in the cellular compartments, but not anchored to the cell wall (Schneewind et al., 1992). The LPXTG motif is likely the site of proteolytic cleavage and cell wall linkage, whereas the charged tail serves as a retention signal from the export pathway during cell wall sorting. We wished to define the molecular signal encoded in the charged tail of protein A. A serine scan experiment was performed, in which serine replaced single as well as multiple residues of the charged tail. In a reciprocal experiment, we tested if specific residues within a polyserine tail were sufficient for cell wall anchoring. Serine appeared well suited for this experiment because it should not have contributed significant hydrophobicity to the neighboring C-terminal hydrophobic domain. The effects on cell wall sorting of the mutant protein A molecules are summarized in Table II. Single serine replacement of the last two residues of the charged tail (RRRES, RRRSL) did not affect cell wall anchoring, and substitution of any of the three arginine residues caused only 5% of the mutant protein to be secreted into the medium (SRREL, RSREL, RRSEL). Serine substitution of two neighboring residues had a more pronounced effect. Replacement of any two of the last three residues resulted in 20-30% secretion (RRRSS, RRSSL). Substituting the two C-terminal arginine residues (RSSEL) caused 80% of the mutant protein to be secreted, and substitution of the two N-terminal arginine residues (SSREL) completely abolished cell wall sorting. A polyserine tail (SSSSS) replacing the charged tail of wild-type protein A did not have any sorting function. In an arginine scan experiment, single arginine residues in a polyserine tail were tested for their effects on cell wall anchoring. Significant sorting (35%) was only achieved when arginine occupied a position 31 residues distal from the leucine (L) of the LPXTG motif (RSSSS). Single arginine residues at any other position (SRSSS, SSRSS, SSSRS, SSSSR) in the polyserine tail did not anchor the polypeptide chain to the cell wall. Neither lysine nor histidine (KSSSS and HSSSS), two other positively charged amino acids, could substitute for arginine when present at position
Table H. The retention signal encoded by the charged tail Protein A C-terminus
% Cell wall sortinga
100 100 100 .---S 95 ----S -95 ---S---
--R R R E L ------S
--S ----
95
. 70 80 20 o O 35 0 0 0 0 --5---R 0 ---S-S0 .RH---90 --KR --90 --R-R-90 ---RR-30 RRREL 100 -R R R E L 100 --SRRREL 100 --SSRRREL -
- - -
----S S --- S ---S S - - --S S S S S -R- - ---R- ---R ----R-
aDetermined after pulse labeling of staphylococcal cultures and three different assays for cellular topology: cell fractionation, solubility in hot SDS and size difference of muramidase or lysostaphin-released protein. Mutant proteins that failed to anchor to the cell wall were secreted into the medium and directly soluble in hot SDS. Numbers indicate the percentage of muramidase-released protein that migrated more slowly on SDS-PAGE than its lysostaphin-solubilized counterpart.
31. We sought to increase sorting function by testing combinations of two arginine residues at positions 31-33, and found that three combinations (RRSSS, RSRSS, SRRSS) anchored 90% of the mutant protein to the cell wall. We concluded that two positively charged arginine residues following the hydrophobic domain at positions 31-33 from the LPXTG motif are both necessary and sufficient for retention of the polypeptide chain during cell wall sorting of protein A. The C-terminal hydrophobic domain determines the position of the charged tail Although several different sorting signals anchored fusion proteins to the staphylococcal cell wall, others failed to do so. In order to determine the reason for this, three signals, CNA, EMM and WAP, each of which conferred a different cellular location onto its fusion protein, were chosen for further study. We first examined whether the charged tail of the EMM sorting signal was responsible for its sorting failure (2, Figure 3). The SPA charged tail (RRREL) was exchanged with that of EMM (KRKEEN) and vice versa. The SPAKRKEEN protein was localized to the cell wall compartment and remained insoluble in hot SDS unless the peptidoglycan was degraded (3, Figure 3). Treatment with Hash-muramidase caused SPARKEEN to migrate as several distinct bands on SDS -PAGE and more slowly than the lysostaphin-released counterpart. In contrast, the
4807
O.Schneewind, D.Mihaylova-Petkov and P.Model
SPA -EMMRRREL protein was detected in the medium (70%) and cell wall compartment, and it was partially soluble after boiling the pulse-chase sample in hot SDS (4, Figure 3). Most of the muramidase-solubilized species
displayed the same migration on SDS -PAGE as its lysostaphin-released counterpart, suggesting that 20% of the mutant protein was anchored to the cell wall. The EMM charged tail is positioned 30 residues distal from the leucine (L) of the LPXTG motif, whereas the protein A charged tail is located at position 31 (Figure 3A). We tested whether adding a single or two serine residues to the C-terminal hydrophobic domain would increase cell wall anchoring of the EMM sorting signal. A SPA -EMM hybrid with the protein A charged tail at position 31 (SPA-EMMmRREL+1) was found in the cell wall (70%) and the medium (5, Figure 3). SPA-EMMRRREL+ 1 was partially soluble after boiling the pulse-chase samples in hot SDS. Hash-muramidase released most of the hybrid protein with a slower mobility on SDS -PAGE as compared with the lysostaphin-solubilized form, indicating that 70% of the mutant protein was anchored to the cell wall. The addition of two serine residues to the C-terminal hydrophobic domain of the EMM signal (SPA -EMMRRREL+2) increased cell wall anchoring even further to 85% (6, Figure 3). The CNA charged tail is positioned 28 residues from the LPXTG motif (7, Figure 3); its position was changed to 31 residues by adding three amino acids to the C-terminal side of the hydrophobic domain (8, Figure 3). We employed valyl-alanyl-glycyl since serine residues could not be introduced for technical reasons. This mutant protein,
SPA-CNA+3, was immunoprecipitated predominantly
from the cell wall compartment, and it remained insoluble in hot SDS unless the peptidoglycan was degraded (8, Figure 3). Most of the muramidase-released species of SPA-CNA+3 migrated more slowly on SDS -PAGE than the lysostaphin-solubilized counterpart, suggesting that the mutant protein was mostly anchored to the cell wall. The WAP sorting signal is shorter than the protein A signal, 31 residues as compared with 35, and the WAP charged tail is located at position 29 from the LPXTG motif (9, Figure 3). The WAP signal was mutated by adding the protein A charged tail to its C-terminus so that the mutant Fig. 3. Spacing between the LPXTG motif and the charged tail as a determinant of cell wall anchoring. (A) C-terminal sequences of protein A hybrids: 1. wild-type protein A, SPA; 2. SPA-EMM; 3. EMM charged tail replacing the SPA tail, SPAKRKcEEN; 4. SPA 5. a serine charged tail replacing the EMM tail, residue added to the hydrophobic domain of (4), SPA-EMMRRREL+ ; 6. two serine residues added to the hydrophobic domain of (4), SPA-EMMRRREL+2; 7. SPA-CNA; 8. three residue extension of the CNA hydrophobic domain, SPA-CNA+3; 9. SPA-WAP; 10. WAP with a C-terminal fusion of the SPA charged tail, SPA-WAPRRREL. (B) Staphylococcus aureus OS2 expressing genes of protein A hybrids was pulse labeled with [35S]methionine for 1 min and chased with non-radioactive amino acids for 5 min. The culture was fractionated into medium (MD), cell wall (CW), cytoplasm (C) and membrane (M) compartments. In parallel, 1 ml of culture was pulse labeled, chased for 5 min and 500 1l each precipitated with TCA. One of these samples was lysostaphin digested (L) prior to boiling in hot SDS, whereas the other sample (CH) was directly boiled in hot SDS. Proteins were immunoprecipitated with anti-SPA and subjected to 10% SDS-PAGE. (C) One milliliter of Saureus OS2 culture expressing genes of protein A hybrids was pulse labeled with [35S]methionine for 1 min, chased with non-radioactive amino acids and 500 A1 each precipitated with TCA. The two samples were digested with either lysostaphin (L) or Hash-muramidase (H), and precipitated with TCA. Proteins were solubilized in hot SDS, immunoprecipitated with antiSPA and subjected to 10% SDS-PAGE. Molecular weight markers are indicated (kDa).
SPA-EMMRRPJEL;
-
4808
...
m*
Cell wall sorting signals
sorting signal is 35 residues in length. Upon cell fractionation, this mutant protein, SPA-WAPRRJJEL, had the same cellular locations as the SPA-WAP hybrid (10, Figure 3). Both hybrid proteins were immunoprecipitated from the membrane, cell wall and medium, and they were partially soluble when the pulse-chase samples were directly boiled in hot SDS. The muramidase-released hybrid proteins migrated at the same rate on SDS -PAGE as their lysostaphin-solubilized counterparts (9 and 10, Figure 3), indicating that no cell wall anchoring had occurred. We also tested if altering the spacing between the LPXTG motif and the charged tail of the protein A signal (31 residues) would reduce its sorting ability. A spacing of 30, 32 or 33 residues did not affect cell wall anchoring, but a protein A mutant with a spacing of 29 residues was mostly (70%) secreted into the medium (Table II).
Discussion Four distinct cellular compartments can be identified in Gram-positive bacteria: the cytoplasm, the membrane, the medium and the cell wall. After synthesis in the cytoplasm, proteins can reach all other compartments by entering the protein export pathway by means of an N-terminal leader peptide. Depending on the presence or absence of a stop-transfer segment (Davis and Model, 1985), proteins are respectively either integrated into the cytoplasmic membrane or secreted into the surrounding medium, the two default locations of protein export in this simple cell system. Proteins destined for the cell wall compartment require a short sorting signal located at their C-terminus.
The cell wall sorting signal Enterotoxin B (SEB) is normally secreted into the medium, but can be anchored to the staphylococcal cell wall by fusion with 35 C-terminal protein A residues. The SEB leader peptide is therefore sufficient as an export signal for cell wall anchoring, suggesting that no specific sorting information is encoded in the leader peptide. The cell wall sorting signal of protein A consists of an LPXTG motif, a C-terminal hydrophobic domain and a charged tail. Homologous sequence elements have been found in more than 50 proteins of Gram-positive bacteria, many of which have been shown to be surface displayed. Their mode of anchoring, however, has generally not been determined. Testing 10 such homologous signals for cell wall sorting function, we found that many signals are able to anchor either protein A or SEB fusion proteins to the cell wall. Surprisingly, the behavior of some sorting signals from the same bacterial species differs in our assays (TEE and EMM of S.pyogenes, CNA and FNBP of S.aureus). We surmise that in their native hosts all of these surface proteins are anchored to the cell wall, although some proteins may require specific sorting conditions not yet identified. Thus, cell wall sorting of surface proteins appears to be evolutionarily conserved in many Gram-positive bacteria. A repetitive proline-rich region is found upstream of the LPXTG motif in protein A as well as in a number of other surface proteins (Guss et al., 1984; Uhlen et al., 1984). Although this region is clearly not required for cell wall sorting, its specific structure may facilitate spanning of the staphylococcal peptidoglycan.
The C-terminal hydrophobic domain and the charged tail Mutagenesis experiments revealed that retention from the export pathway depends on the presence of at least two arginine residues 31-33 residues from the LPXTG motif of protein A. In contrast to single arginine residues, neither lysine nor histidine had any sorting function when located 31 residues from the LPXTG motif within a polyserine tail. It is possible that lysine or histidine can contribute to sorting function in concert with arginine residues since the charged tail of EMM (KRKEEN) can functionally substitute the protein A charged tail (RRREL). The C-terminal hydrophobic domains of cell wall sorting signals are variable in sequence and length. The spacing from the leucine (L) of the LPXTG motif to the first positively charged amino acid is also variable from 28 to 31 residues in the sorting signals under study (Table I). Some sorting signals with a spacing of 28 (CNA) or 30 (EMM) residues failed to sort fusion proteins to the cell wall, but they acquired sorting activity once the length was increased to 31 and 32 residues, respectively. When the spacing of the protein A sorting signal was altered from 31 to 29 residues, the sorting activity was significantly reduced. These findings demonstrate the importance of the spacing between the charged tail and the LPXTG motif, presumably the site of proteolytic cleavage and covalent cell wall linkage. We tiink it is likely that the geometric distance between the LPXTG motif and the charged tail is determined by protein folding since both functional and non-functional sorting signals can have the same number of residues between the LPXTG motif and the first positively charged amino acid of the charged tail. The number of arginine residues required for cell wall sorting depends on the spacing between the LPXTG motif and the charged tail. A single arginine at the position 31 residues from the LPXTG motif had a partial sorting effect, but two adjacent arginines were necessary when present distal to position 31. The charged tails of many sorting signals often contain three or more positively charged residues, which may indicate some redundancy of the retention signal. This argument is supported by the finding that cell wall anchoring was not affected when the position of the protein A charged tail was changed from 31 to 30, 32 or 33 residues if three arginine residues were maintained in the charged tail. It has not been determined whether a critical amount of hydrophobicity is required in the C-terminal hydrophobic domain for cell wall sorting to occur. All cell wall sorting signals contain a string of at least 15 hydrophobic residues, which is sufficient to span the lipid bilayer. In the absence of sorting function, some of the C-terminal hydrophobic domains conferred a membrane topology onto fusion proteins (CNA, FIM), while others did not (EMM). In contrast to
GPI-anchored proteins (Boothroyd et al., 1981), we never observed a membrane-anchored intermediate during cell wall sorting of protein A, even upon cooling of staphylococcal cultures (Schneewind et al., 1992). Thus, cell wall sorting is a very rapid and efficient process. This may also indicate that the C-terminal hydrophobic domain is associated with a membrane pore structure rather than with the lipid bilayer. In this respect, it is noteworthy that all C-terminal hydrophobic domains contain several glycines. Glycine residues have been implicated in the association of transmembrane domains (Cosson and Bonifacino, 1992; Lemmon et al., 1992), occasionally in conjunction with the formation of interhelical salt bridges (Cosson et al., 1991). 4809 NNW
O.Schneewind, D.Mihaylova-Petkov and P.Model
Surface exposure of proteins in Gram-positive bacteria The precise nature of anchorage has been determined for only few surface proteins of Gram-positive bacteria. Our experiments have shown that surface proteins can be anchored in either the cytoplasmic membrane or the cell wall of S.aureus. Surface proteins anchored in either location resisted extraction with hot SDS. An investigation of the anchor mode of surface proteins therefore requires cell fractionation and solubilization of cell wall-anchored molecules with two different bacteriolytic enzymes. The Cterminal sorting signal of staphylococcal collagen adhesin (CNA) anchored hybrid proteins in the cytoplasmic membrane even in its natural host, S.aureus strain FDA574. Although the cellular location of the wild-type CNA molecule has not yet been determined, it may be possible that some sorting signals allow both membrane and cell wall anchoring of surface proteins, depending on the presence or absence of specific cell wall sorting factors.
Materials and methods Bacterial strains and reagents Staphylococcal strains RN4220 (Kreiswirth et al., 1983), 8325-4 (Novick, 1967), FDA574 (Patti et al., 1992) and S6 (Ranelli et al., 1985) have been previously described. Staphylococcus aureus OS2 (Schneewind et al., 1992) (RN4220, spa-) was used as a host for recombinant plasmids and was transformed with the protoplast technique (Chang and Cohen, 1979). Escherichia coli strain K38 (Garen and Zinder, 1955) was used for all cloning procedures. Chromosomal DNA from the following bacterial strains was used for PCR amplification of cell wall sorting signals: L.monocytogenes L028 (Kocks et al., 1992) and EGD (Gaillard et al., 1991), A.viscosus T14V (Yeung and Cisar, 1990), S.agalactiae SB35 (Heden et al., 1991), S.mutans strain Ingbritt (Ferretti et al., 1989), S.sobrinus UAB66 (Goldschmidt et al., 1990), E.faecalis OG1RF (Kao et al., 1991), S.pyogenes D471 (Hollingshead et al., 1986). All chemicals were purchased from Sigma (St Louis, MO) unless otherwise noted.
Plasmids A shuttle vector, pRIT5 (Nilsson et ad, 1985), for use in E.coli and S.aureus was modified by digestion with NdeI and HindIll, filling the ends with Klenow polymerase, and self-ligation to generate pOS1. DNA fragments coding for SEB hybrids were cloned between the EcoRI and BamHI sites of pOSI. The seb gene (Jones and Khan, 1986) was polymerase chain reaction (PCR) amplified from chromosomal DNA of S. aureus S6 with two primers, seb-l (5'-GAATTCGTATATAAGTTTAGGTGATGT) and seb-3 (5'-AAGGATCCTTAATTACTAACTCTTCATATTT), and cloned via abutted EcoRl and BamHI sites. Another PCR amplification with seb-1 and seb-4 (5'-AAAAGCTTCTTTGTCGTAAGATAAACTTCA) generated a 3'-HindH site for C-terminal fusions. Protein A sequences were excised with HindIll and BamHI from previously described plasmids (Schneewind et al., 1992) and ligated to the 3'-HindLI site of seb to generate
pSEB-SPA459_524, pSEB-SPA490_524,
pSEB-SPA496-524-
DNA sequences coding for sorting signals and stop-transfer segments were PCR amplified from chromosomal DNA of different bacterial species and cloned between Kpnl-BamHI sites of the fusion vectors pSPAKpPJ and pSEB-SPA. The primers were designed such that the fusion site is five residues upstream of the LPXTG motif and downstream of the stop codon. The plasmid pSPAKpnl codes for a protein A mutant with a two amino acid insertion (Gly-Thr) at position 484. The 5'-sequences of spa (Uhlen et al., 1984) were amplified with spa-I (5'-AAGGATCCAAATACATACAGGGGGTATTAA) and spa-13 (5'-AAGGTACCAGCATCTGCATGGTTTGCT) and digested with HindiH and KpnI. The 3'-part of spa was amplified with spa-12 (5'-AAGGTACCAACAAAGCTCAAGCATTACCAGA) and spa-2 (5'-AAGGATCCTTATCATTTCAAATAAGAATGTGTT), and digested with KpnI and BamHI. Both fragments were ligated into pSPA (Schneewind et al., 1992) cut with Hindm and BamHI to construct pSPAKpnI. The plasmid pSEB-SPA codes for a fusion protein that has a KpnI-fusion site abutted to the C-terminal lysine residue of SEB. The seb sequences were PCR amplified with seb-l and seb-5 (5'-AAGGTACCTTTCTTTGTCGTAAGATAAACTTCA) and digested with EcoRI and KpnI. This fragment was recombined with the 3'-part of the spa gene (KpnI-BamHI) and with pOSI digested EcoRI-BamHI to generate
pSEB-SPA. 4810
Mutations of the protein A charged tail were generated by NAeI-BamHI cassette mutagenesis of vector pSPANheI. This plasmid has an NAeI site corresponding to leucine 517 and a BamHI site following the stop codon. The plasmid pSPANheI was constructed by amplifying spa 5'-sequences with spa-I and spa-14 (5'-TTTTGCTAGCAACGCTGCACCTAAGGCTAA), digestion with Hindm and NheI, and recombination with a linker and with pSPA cut Hindll-BamHI. Two oligonucleotides, for the wild-type charged tail spa-15 (5'-CTAGCTGGACGTCGTCGCGAACTATAAG) and spa-16 (5'-GATCCTTATAGTTCGCGACGACGTCCAG), were ligated to the Nhe and BamHI sites of pSPANheI. Cassette mutagenesis was also employed to mutagenize the charged tails of the EMM and CNA sorting signals. The EMM signal was amplified with m-I (5'-AAGGTACCGAAACTAAGAGACAGTTACCAT) and m-3 (5'-TTTTCGGCCGCTACTCCAGCTGTTGCCA), and digested with KpnI-EagI. This fragment was recombined with pSPAKDnI cut KpnI-BamHI and the oligonucleotides m-4 (5'-GGCCGTTGTACGTCGTCGCGAACTATAAG) and m-5 (5'-GATCCTTATAGTTCGCGACGACGTACAAC). The CNA signal was amplified with cna-l (5'-AAGGTACCAATCCTCTAAAAGAATTACCAAAA) and cna-3 (5'-AAACTAGTATTAAATACAGTACCAA) and digested with KpnI and SpeI. This fragment was recombined with pSPAKpPJ cut KpnI-BamHI and the oligonucleotides cna-4 (5'-CTAGTAGCTGGAAGAAAAAGATTTAACTCATAAG) and cna-5 (5'-GATCCTTATGAGTTAAATCTTTTTCTTCCAGCTA). The sequences of the mutagenic oligonucleotides can be obtained from the authors upon request. Al constructs were cloned and sequenced in Ecoli, transformed into Saureus OS2, plasmids purified, analyzed by restriction digests and finally sequenced. Muramidase and lysostaphin release of protein A Staphylococcus aureus strains 8325-4 and RN4220 were grown in minimal medium until OD6W reached 0.5 and 1 ml of culture was pulse labeled with 100 ACi [35S]methionine for 1 min and chased with non-radioactive amino acids for 5 min. The cultures were precipitated with TCA to 5 %, washed in acetone, and dried under vacuum. The precipitates were digested with either lysostaphin [1 ml 0.5 M Tris-HCl (pH 8.0), 100 ytg/ml lysostaphin (Applied Microbiology Inc., New York, NY)] or muramidase [1 ml 0.05 M sodium acetate (pH 5.7), 100 jig/ml muramidase] for 2 h at 37°C (Dr John Hash, Vanderbilt University, has generously made Chalaropsis B muramidase available to us). The digests were precipitated with TCA, acetone washed, dried under vacuum and boiled in SDS [100 A1 4% SDS, 0.5 M Tris-HCl (pH 8.0)]. Twenty microliters of the samples were immunoprecipitated in duplicate with protein A-specific antiserum and protein A beads. The beads were washed five times in Triton buffer (see below) and the immunocomplexes were digested on the beads with lysostaphin [50 I1 0.05 M Tris-HCl (pH 8.0) and 1 zg lysostaphin] or mock treated [50 1l 0.05 M Tris-HCl (pH 8.0)] for 1 h at 37°C. The liquid supernatant was removed and the immunoprecipitates were boiled in sample buffer prior to separation on 10% SDS-PAGE. Assays for cell wall sorting Staphylococcal cultures were grown overnight in chemically defined medium, diluted 1:20 into minimal medium and the cultures were pulse labeled when they reached OD6W 0.5. After metabolic labeling with 100 /ACi [35S]methionine for 1 min, the pulse was chased with 50 ,ud chase solution (100 mg casamino acids, 10 mg methionine/ml) for 5 min. Cellfractionations. One milliliter of staphylococcal culture was pulse labeled and the cells were recovered by centrifugation for 4 min at 13 000 r.p.m. The supernatant was removed and precipitated with TCA (medium), and the cells were lysostaphin digested for 10 min at 370C in 500 ,l SMM buffer [0.5 M sucrose, 0.02 M maleate, 0.02 M MgCl2 (pH 6.5), 100 ,g/ml lysostaphin]. The protoplasts were collected by centrifugation for 4 min at 13 000 r.p.m. and the supernatant was removed and precipitated with TCA (cell wall fraction). The protoplasts were lysed in 250 1l membrane buffer [0.1 M NaCl, 0.1 M Tris-HCl, 0.01 M MgCl2 (pH 7.5)] with five cycles of freeze-thawing in a dry-ice ethanol bath. The membranes were pelleted by ultracentrifugation in a Beckman TL-100 instrument at 200 000 g for 30 min. The supernatant (cytoplasm) and the pellet (membranes) were separated and precipitated with TCA. Membrane proteins (SEB-ACTA, SPA-PII) were subjected to an alkaline extraction of membranes, a procedure that integral membrane proteins are known to resist. After pulse labeling and cell fractionation, the staphylococcal membranes were pelleted in triplicate. The membrane pellets were extracted with either 0.1 M NaCl buffer, 0.1 M Na2CO3 buffer of pH 11.5 or 1% Triton X-100 buffer, and again collected by ultracentrifugation. The supematants and pellets were separated, precipitated with TCA and analyzed for the distribution of the hybrid proteins. The results revealed that both fusion proteins resisted extraction with either salt or alkali and pelleted with the membrane, whereas Triton-X 100 solubilized the hybrid proteins, which remained in the supematant.
Cell wall sorting signals Pulse-chase experiments. One milliliter of culture was pulse labeled and chased for 5 min, split into 500 Al each and precipitated with TCA. After TCA precipitation and an acetone wash, one of the two chase samples was lysostaphin digested (500 Al 0.5 M Tris-HCl, 100 Ag/ml lysostaphin) for 30 min at 37°C and again precipitated with TCA prior to boiling in hot SDS. The other of the two samples was direcdy boiled in hot SDS. Muramidase and lysostaphin treatment. One milliliter of culture was pulse labeled and chased for 5 min, split into two 500 1l samples and precipitated with TCA. One sample was lysostaphin digested as described above, whereas the other sample was muramidase treated for 2 h at 37°C [500 1l 0.05 M sodium acetate (pH 5.7), 100 jg/ml Chalaropsis B muramidase from a 2 mg/ml stock in 0.05 M sodium acetate (pH 5.0)]. Both samples were then precipitated with TCA. All samples were precipitated with 5% TCA and washed in 1 ml of acetone. The samples were dried under vacuum and resuspended in 50 $1 0.5 M Tris-HCI (pH 8.0), 4% SDS, boiled for 10 min, and the insoluble material was removed by centrifugation (4 min at 13 000 r.p.m.) immediately prior to immunoprecipitation. Twenty microliters of sample were added to antiserum diluted 1: 1000 into 1 ml of Triton buffer [0.05 M Tris-HCI, 0.15 M NaCl, 0.005 M EDTA, 1 % Triton-X 100 (pH 7.5)] and incubated for 60 min. Protein A CL-4B Sepharose beads, 40 Al slurry, were added and the immunocomplexes were collected with gentle shaking for 60 min. The beads were washed five times in Triton buffer, boiled for 10 min in sample buffer, and the supernatant separated on either 10% (SPA) or 12% (SEB) SDS-PAGE prior to fluorography. Prestained molecular weight markers from GIBCO-BRL (Gaithersburg, MD) were included as molecular weight controls.
Acknowleduements We would like to thank John Hash for his generous gift of Chalaropsis B muramidase. We are indebted to Christine Canzanella for editing the manuscript, and to Virginia Miller, Jeff Miller, William Navarre, Greg Payne and Marjorie Russel for reading and revising the manuscript. We also thank John Cisar, Roy Curtiss HI, Gary Dunny, Joseph Ferretti, Gunnar Lindahl, Saleem Khan, Joseph Patti and Dan Portnoy for sending us strains. Research described here was supported by grants from the Public Health Service AI33985 and by start-up funds from the Department of Microbiology & Immunology and the UCLA School of Medicine to O.S. Work in P.M.'s laboratory is supported by a grant from the National Science Foundation DMB8817641.
References Baranski,T.J., Faust,P.L. and Kornfeld,S. (1990) Cell, 63, 281-291. Blobel,G. (1980) Proc. Natl Acad. Sci. USA, 77, 1496-1500. Boothroyd,J.C., Paynter,C.A., Cross,G.A.M., Bernards,A. and Borst,P. (1981) Nucleic Acids Res., 9, 4734-4742. Brown,D.A. and Rose,J.K. (1992) Cell, 68, 533-544. Brumfitt,W., Wardlaw,A.C. and Park,J.T. (1958) Nature, 181, 1783-1784. Chang,S. and Cohen,S.N. (1979) Mol. Gen. Genet., 168, 111-115. Collawn,J.F., Stangel,M., Kuhn,L.A., Esekogwu,V., Jing,S., Trowbridge,I.S. and Tainer,J.A. (1990) Cell, 63, 1061-1072. Cosson,P. and Bonifacino,J.S. (1992) Science, 258, 659-662. Cosson,P., Lankford,S.P., Bonifacino,J.S. and Klausner,R.D. (1991) Nature, 351, 414-416. Davis,N.G. and Model,P. (1985) Cell, 41, 607-614. Davis,N.G., Boeke,J.D. and Model,P. (1985) J. Mol. Biol., 181, 111-121. Ferretti,J.J., Russel,R.R.B. and Dao,M.L. (1989) Mol. Microbiol., 3, 469-478. Gaillard,J.-L., Berche,P., Frehel,C., Gouin,E. and Cossart,P. (1991) Cell, 65, 1127-1141. Garen,A. and Zinder,N.D. (1955) Virology, 1, 347-376. Gennity,J.M. and Inouye,M. (1991) J. Biol. Chem., 266, 16458-16464. Ghuysen,J.-M. (1968) Bacteriol. Rev., 32, 425-464. Ghuysen,J.-M. and Strominger,J.L. (1963) Biochemistry, 2, 1119- 1125. Goldschmidt,R.M., Thoren-Gordon,M. and Curtiss,R. (1990) J. Bacteriol., 172, 3988-4001. Gottschalk,S., Waheed,A., Schmidt,B., Laidler,P. and Figura,K.v. (1989) EMBO J., 8, 3215-3219. Guss,B., Uhlen,M., Nilsson,B., Lindberg,M., Sjoquist,J. and Sjodahl,J. (1984) Eur. J. Biochem., 138, 413-420. Gutierrez,L., Magee,A.I., Marshall,C.J. and Hancock,J.F. (1989) EMBO J., 8, 1093-1098. Hash,J.H. and Rothlauf,M.V. (1967) J. Biol. Chem., 242, 5586-5590. Hash,J.H., Wishnick,M. and Miller,P.A. (1964) J. Bacteriol., 87, 432-437.
Heden,L.-O., Frithz,E. and Lindahl,G. (1991) Eur. J. Immunol., 21, 1481-1490. Hollingshead,S.K., Fischetti,V.A. and Scott,J.R. (1986) J. Biol. Chem., 261, 1677-1686. Jackson,M.R., Nilsson,T. and Peterson,P.A. (1993) J. Cell Biol., 121, 317-333. Jones,C.L. and Khan,S.A. (1986) J. Bacteriol., 166, 29-33. Kao,S.-M., Olmsted,S.B., Viksnins,A.S., Gallo,J.C. and Dunny,G.M. (1991) J. Bacteriol., 173, 7650-7664. Kocks,C., Gouin,E., Tabouret,M., Berche,P., Ohayon,H. and Cossart,P. (1992) Cell, 68, 521-531. Kreiswirth,B.N., Lofdahl,S., Betley,M.J., O'Reilly,M., Schlievert,P.M., Bergdoll,M.S. and Novick,R.P. (1983) Nature, 305, 709-712. Lemmon,M.A., Flanagan,J.M., Treutlein,H.R., Zhang,J. and Engelman,D.M. (1992) Biochemistry, 31, 12719-12725. Lobel,P., Fujimoto,K., Ye,R.D., Griffiths,G. and Kornfeld,S. (1989) Cell, 57, 787-796. Moks,T., Abrahmsen,L., Nilsson,B., Hellnan,U., Sjoquist,J. and Uhlen,M. (1986) Eur. J. Biochem., 156, 3577-3588. Munoz,E., Ghuysen,J.-M., Lehy-Bouille,M., Petit,J.-F., Heymann,H., Bricas,E. and Lefrancier,P. (1966) Biochemistry, 5, 3748-3764. Nilsson,B., Abrahmsen,L. and Uhlen,M. (1985) EMBO J., 4, 1075-1080. Novick,R.P. (1967) Virology, 33, 155-166. Pancholi,V. and Fischetti,V.A. (1988) J. Bacteriol., 170, 2618-2624. Patti,J.M., Jonsson,H., Guss,B., Switalski,L.M., Wiberg,K., Lindberg,M. and Hook,M. (1992) J. Biol. Chem., 267, 4766-4772. Pelham,H.R.B., Hardwick,K.G. and Lewis,M.J. (1988) EMBO J., 7, 1757-1762. Pryer,N.K., Wuestehube,L.J. and Schekman,R. (1992) Annu. Rev. Biochem., 61, 471-516. Ranelli,D.M., Jones,C.L., Johns,M.B., Mussey,G.J. and Khan,S.A. (1985) Proc. Natl Acad. Sci. USA, 82, 5850-5854. Schindler,C.A. and Schuhardt,V.T. (1964) Proc. NatlAcad. Sci. USA, 51, 414-421. Schneewind,O., Jones,K.F. and Fischetti,V.A. (1990) J. Bacteriol., 172, 3310-3317. Schneewind,O., Model,P. and Fischetti,V.A. (1992) Cell, 70, 267-281. Signas,C., Raucci,G., Jonsson,K., Lindgren,P.-E., Anantharamaiah,G.M., Hook,M. and Lindberg, M. (1989) Proc. Natl Acad. Sci. USA, 86, 699-703. Sjoquist,J., Meloun,B. and Hjelm,H. (1972a) Eur. J. Biochem., 29, 572-578. Sjoquist,J., Movitz,J., Johansson,I.-B. and Hjelm,H. (1972b) Eur. J. Biochem., 30, 190-194. Strominger,J.L. and Ghuysen,J.-M. (1967) Science, 156, 213-221. Switalski,L.M., Patti,J.M., Butcher,W., Gristina,A.G., Speziale,P. and Hook,M. (1993) Mol. Microbiol., 7, 99-107. Tipper,D.J., Ghuysen,J.-M. and Strominger,J.L. (1965) Biochemistry, 4, 468-473. Tipper,D.J., Strominger,J.L. and Ensign,J.C. (1967) Biochemistry, 6, 906-920. Tokuda,M., Okahashi,N., Takahashi,I., Nakai,M., Nagaoka,S., Kawagoe,M. and Koga,T. (1991) Infect. Immun., 59, 3309-3312. Tweten,R.K. and Iandolo,J.J. (1983) J. Bacteriol., 153, 297-303. Uhlen,M., Guss,B., Nilsson,B., Gatenbeck,S., Philipson,L. and Lindberg,M. (1984) J. Biol. Chem., 259, 1695-1702. Yeung,M.K. and Cisar,J.O. (1990) J. Bacteriol., 172, 2462-2468.
Received on July 9, 1993; revised on August 17, 1993
4811