This assumes an embryo 0.3mm long. Unc-GC. Max prod. regulatory weights (Tab). Bias Decay Diff. Gene rate (Ra). Bcd. Cad. Hb. Kr. Gt. Kni. Tll. (ha). (λa). (Da).
diffusion rates have units (1% embryo length)2 minâ1. To obtain the diffusion rates in the more traditional units of cm2secâ1, one should multiply by 1.5Ã10â9.
Detailed protocol for designing the miRNA cassette, splice-PCR and cloning into pKK- ... that miRNA cassette is subcloned first and the CDS is cloned second. ... sequences can be beneficial for splice-PCR but is not obligatory (see step 5.7).
Online Supporting Information S3. A protocol guide for iDNA-Prot web-server. For the convenience of the vast majority of experimental scientists, here let us give ...
SD Walter 2 .... threshold for excluding patients to
UHCW NHS Trust. University Hospital. Clifford Bridge Rd. Coventry CV2 2DX. Tel: 02476 965 670. E-mail: [email protected]. Dr Daniel Zehnder.
IMG-4/pUESCαf-FS(N) α-factor display by FS(N) anchor. IMG-4/pUESCαf-FS(C) α-factor display by FS(C) anchor. Figure S3. IMG-50/pGK-SSTR5-HA/pGK42.
S3 Appendix. Characterisation of bovine AgB. Composition of native AgB: bQSf apolipoproteins identification by 2-DGE plus MALDI-TOF/TOF and bLdf lipid ...
Table S3. Data points of locus of oscillations with less than 20% of correlation in the first period in the stochastic model (Fig. S4). k8 (hourâ1) kmin. 9. (molecules ...
Table S3. Oligonucleotides. Name. Sequence (5'-3') a. Restriction site b. FWPpqsH. CCGCTCGAGGGTCGTGCATGCTTGCCG. XhoI. RVPpqsH.
Figure S3. Neutralization titres against H1N1pdm. The location of each pie chart indicates neutralization tire at baseline (x-axis) and at follow-up (y-axis).
S3 Table. Values of tyrosinase inhibition for Lippia origanoides essential oils using the substrate L-tyrosine. Samples inhibition (%). Experiment. Kojic acid. LiOr- ...
Table S3 Mean difference (X±SE) of bone mass density (BMD) at each region: L1, ... 3, L1-4, L2-3, L2-4, L3-4, femur neck, hip ward, femur trochanteric, hip total, ...
Table S3: Conversion of wavelength data for predicted reflectance peaks to RGB values. Method 1. Method 2. Method 3. Average location of scales predicted ...
Table S3: Genes exhibiting circadian expression pattern. Genes highlighted in yellow also display diurnal patterns of expression. Known circadian genes CCA1 ...
B. VFLYIKKVVKKPKDNEILPPAARRQDPQEMEDYPGHNTAAPVQETLHGCQPVTQEDGKESRISVQERQVTDSIALRPLV. TRAF6. TRAF2/3. Box2. mT6. mT23.
S3 Fig. Comparison with the structure of MERS-CoV Mpro with that of SARS-. CoV Mpro (A) and those of ligand-bound complex, dimeric C148A mutant and bat-.
cluster, its tag SNP was chosen by the minimax algorithm implemented in ... we fit a Bayesian liability regression model with 'no weight' on all tag SNPs and ...
Table S3. Sources of the 13 networks analyzed in this work. Networks. Sources. Characters in "Les Miserables". 1. Words in "David Copperfield". 2. Dolphins. 3.
Methylation sensitive enzymes cleave the amplicon at 11 sites: 60°C. BstUI cleaves at CGCG. 5 cuts at bases 43, 81, 93, 95, 105. 37°C. HhaI cleaves at GCGC.
Protocol S3. Determination of ... a stock solution 10 mM in. DMSO. Mobile Phase A:50 mM Ammonium Acetate aqueous solution, pH adjusted to 7.4 and 10.5.
Protocol S3. Determination of compounds Chromatographic Hydrophobicity Index (CHI) at acidic, neutral and alkaline pHs. The determination of compounds Chromatographic Hydrophobicity Index (CHI) at acidic, neutral and alkaline pHs was accomplished by retention time measurements using Luna C18 columns obtained from Phenomenex. The column dimensions were 50 x 3 mm, particle size, 5 um. Compounds analysed were dissolved in Acetonitrile (0.5 mM) from a stock solution 10 mM in DMSO. Mobile Phase A:50 mM Ammonium Acetate aqueous solution, pH adjusted to 7.4 and 10.5 by addition of concentrated ammonia solution and 0.01M concentrated phosphoric acid in water, pH 2. Mobile Phase B: Acetonitrile. HPLC Method: flow rate: 1.0 ml/min, temperature: 30ºC, gradient: 0 to 3.0 min 0 to 100% B solvent; 3.0 to 3.5 min. 100% B solvent (Acetonitrile); 3.5 to 3.7 min. from 100% B to 0% B. Total run time 5 min. Calibration set of compounds: Theophylline, Phenyltetrazole, Benzimidazole, Colchicine, Phenyltheophylline, Acetophenone, Indole, Propiophenone, Butyrophenone, Valerophenone. The calculation of the Chromatographic Hydrophobicity data expressed as CHILogD was carried out as previously described [1]. References. 1. Valko K. (2002) Measurement and predictions of physicochemical properties. Eaton Publishing, Westborough, MA.
