B. VFLYIKKVVKKPKDNEILPPAARRQDPQEMEDYPGHNTAAPVQETLHGCQPVTQEDGKESRISVQERQVTDSIALRPLV. TRAF6. TRAF2/3. Box2. mT6. mT23.
S3 Fig. Comparison with the structure of MERS-CoV Mpro with that of SARS-. CoV Mpro (A) and those of ligand-bound complex, dimeric C148A mutant and bat-.
S3 Fig: Inhibition of ERK½ phosphorylation by U0126. Representative blots showing effect of U0126 pre-treatment on phosphorylation of ERK½ with or without ...
S3 Fig. Virtual cut through an array of helical (or sinusoidal) tubules obtained through a series of successive cuts through individual tubules. Simulation of the.
Percent of control. Percent of control. Percent of control. -a-HA a-HA a-L1. T a-HA va-L1 a-L1. 0.1% +TIT. 0.1%. +. TTT. 0.1% +TTTTT. 1. 0.01. 0.1. 100. 000 L. 10.
S3 Fig. Species accumulation curves based on different bacterial taxonomic categories: phylum to family (a), genera (b), and OTU0.03 level (c). Colors in a) ...
Sox7 CKO/+; Tie2-Crex Sox7 CKO/CKO. Sox7 +/-% Sox17 +/-. Genotype of Progeny Live. O. Sox7 CKO/CKO, Tie 2-Cre0. Sox7 +/-; Sox17 +/-. 1. Sox7 --.
S3 Fig. Growth rates (mm d-1) measured as a change in length over the experimental exposure duration for copper and blue rockfish as a function of pCO2 ...
S3 Fig. PNS differentiation from NL+ cells. Ãâ ¢ tubulin. DAPI day14. 100µM. A. % of Max. CD73. CD105. CD90. CD45. CD44. HLA-DR. % of Max.
Figure S3. Percentage of borders of a given robustness score. Data for borders aligning within 10 kb (a) or exactly in the same bin (b). The plot on the left of the ...
0. 2. 4. 0. 5. 10. 15. Cumulative OD65. 0. R. T. R. T. R. T. Stage. 0 Day 2 Day 3 Day 5 Day. 0. 5. 10. 15. Cumulative OD65. 0. Growth after 5 days. (0.5 mM GlcN).
214 bp upstream ZNF627 (chr19:11670053) 344 bp upstream NCOA4 (chr10:51564768). 105 bp upstream EZR (chr6:159240549). 187 bp upstream DDTL ...
Figure S3. Protein levels of wild-type Axin1 and Axin1 mutants in cells with or without. Salmonella colonization. (A) Diagrams of Axin1 mutant constructs. (B).
Shoplifting. 80. 100. 120. 140. 160. Terraced. 280. 300. 320. 340. 360. Theft From Person. â720. â715. â710. â705. â700. Total Crime and ASB. 20. 40. 60. 80.
Day 2 feet. % CHANGE. 0. 5. 10. 15. 20. 0. 0.2. 0.4. 0.6. 0.8. 1. 0. 2. 4. 6. 8. 10. 12. Day 30 feet. % CHANGE. Day 30 feet. COVERAGE. Day 7 feet. % CHANGE. 0.