HERC5 Partial Recombinant Protein

6 downloads 112 Views 152KB Size Report
HERC5 (NP_057407, 915 a.a. - 1025 a.a.) partial recombinant protein with a ~ 26kD N-terminal GST tag. Immunogen. This protein is not active and should not ...
Product Datasheet Recombinant Human HERC5 Protein H00051191-Q01-2ug Unit Size: 2 ug Store at -80C. Avoid freeze-thaw cycles.

Protocols, Publications, Related Products, Reviews, Research Tools and Images at: www.novusbio.com/H00051191-Q01 Updated 11/28/2017 v.20.1

Earn rewards for product reviews and publications. Submit a publication at www.novusbio.com/publications Submit a review at www.novusbio.com/reviews/destination/H00051191-Q01

Page 1 of 2 v.20.1 Updated 11/28/2017

H00051191-Q01-2ug Recombinant Human HERC5 Protein Product Information Unit Size

2 ug

Concentration Storage

Please see the vial label for concentration. If unlisted please contact technical services. Store at -80C. Avoid freeze-thaw cycles.

Buffer

50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Product Description Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 915-1024 of Human HERC5 partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence: YDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTLEEKKKFLVFLTGTDRLQM KDLNNMKITFCCPESWNERDPIRALTCFSVLFLPKYSTMETVEEALQEAINNNR GFG

Gene ID

51191

Gene Symbol

HERC5

Species

Human

Reactivity Notes

Human

Preparation Method

in vitro wheat germ expression system

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Product Application Details Applications

Western Blot, ELISA, Protein Array

Recommended Dilutions

Western Blot, ELISA, Protein Array

Application Notes

Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Novus Biologicals USA

Novus Biologicals Canada

8100 Southpark Way, A-8 Littleton, CO 80120 USA Phone: 303.730.1950 Toll Free: 1.888.506.6887 Fax: 303.730.1966 [email protected]

461 North Service Road West, Unit B37 Oakville, ON L6M 2V5 Canada Phone: 905.827.6400 Toll Free: 855.668.8722 Fax: 905.827.6402 [email protected]

Novus Biologicals Europe

General Contact Information

19 Barton Lane Abingdon Science Park Abingdon, OX14 3NB, United Kingdom Phone: (44) (0) 1235 529449 Free Phone: 0800 37 34 15 Fax: (44) (0) 1235 533420 [email protected]

www.novusbio.com Technical Support: [email protected] Orders: [email protected] General: [email protected]

Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt. For more information on our 100% guarantee, please visit www.novusbio.com/guarantee Earn gift cards/discounts by submitting a review: www.novusbio.com/reviews/submit/H00051191-Q01 Earn gift cards/discounts by submitting a publication using this product: www.novusbio.com/publications

Suggest Documents