B. VFLYIKKVVKKPKDNEILPPAARRQDPQEMEDYPGHNTAAPVQETLHGCQPVTQEDGKESRISVQERQVTDSIALRPLV. TRAF6. TRAF2/3. Box2. mT6. mT23.
S3 Fig. Comparison with the structure of MERS-CoV Mpro with that of SARS-. CoV Mpro (A) and those of ligand-bound complex, dimeric C148A mutant and bat-.
S3 Fig: Inhibition of ERK½ phosphorylation by U0126. Representative blots showing effect of U0126 pre-treatment on phosphorylation of ERK½ with or without ...
S3 Fig. Virtual cut through an array of helical (or sinusoidal) tubules obtained through a series of successive cuts through individual tubules. Simulation of the.
S3 Fig. Species accumulation curves based on different bacterial taxonomic categories: phylum to family (a), genera (b), and OTU0.03 level (c). Colors in a) ...
Sox7 CKO/+; Tie2-Crex Sox7 CKO/CKO. Sox7 +/-% Sox17 +/-. Genotype of Progeny Live. O. Sox7 CKO/CKO, Tie 2-Cre0. Sox7 +/-; Sox17 +/-. 1. Sox7 --.
S3 Fig. Growth rates (mm d-1) measured as a change in length over the experimental exposure duration for copper and blue rockfish as a function of pCO2 ...
S3 Fig. PNS differentiation from NL+ cells. Ãâ ¢ tubulin. DAPI day14. 100µM. A. % of Max. CD73. CD105. CD90. CD45. CD44. HLA-DR. % of Max.
Figure S3. Percentage of borders of a given robustness score. Data for borders aligning within 10 kb (a) or exactly in the same bin (b). The plot on the left of the ...
0. 2. 4. 0. 5. 10. 15. Cumulative OD65. 0. R. T. R. T. R. T. Stage. 0 Day 2 Day 3 Day 5 Day. 0. 5. 10. 15. Cumulative OD65. 0. Growth after 5 days. (0.5 mM GlcN).
214 bp upstream ZNF627 (chr19:11670053) 344 bp upstream NCOA4 (chr10:51564768). 105 bp upstream EZR (chr6:159240549). 187 bp upstream DDTL ...
S3 Fig. Hemocyte phenotypes of ird1 mutants and in ird1-suppressed larvae, with or with- out the Tl10b ... The white frame indicates the segmental area used to ...
The Role of ird1 in Drosophila Blood Cell Activation
B crossed to: >ird1 IR Tl 10b >ird1 IR; Tl 10b
100 75 50 25 0
Hml>
ird1
eater-DsRed 1 mm
25 3
8
+
+
4
Tl >ird1 IR crossed to: +
>ird1 IR Circulating cells per animal
+
50
D 20000
Hml>GFP; Tl 10b
+
75
0
FB>
C
0.012
100 % GFP+ hemocytes
% larvae with nodules (±SD)
A
Schmid et al.
15000
ird1 5 >ird1 IR
He>
Hml> FB>
S3 Fig. Hemocyte phenotypes of ird1 mutants and in ird1-suppressed larvae, with or without the Tl10b allele. A. Mean fraction of larvae with at least one melanotic nodule in three independent crosses, with 50 inspected larvae per indicated genotype and cross. B. Mean fraction of circulating blood cells that express Hml𝛥-Gal4-driven UAS-GFP fluorescence in hemocyte smears from larvae that carry the driver, alone or together with UAS-ird1IR (>ird1IR) in wild-type (+) or Tl10b genetic background. The number of analyzed images is indicated within the bars and the significance level as estimated by MannWhitney U exact test (two-tailed) above. C. The plasmatocyte-specific reporter eater-DsRed visualizes the pattern of sessile cells in third instar larvae heterozygous for the Tl10b allele (Tl10b/+), alone or in combination with either the heterozygous ird1𝛥vps15 allele (ird1𝛥/+) or Hml𝛥-Gal4 (Hml>) driven ird1IR, compared to the wild-type control (+). The UAS-GFP construct was present on the same chromosome as the Hml𝛥-Gal4 driver, but the green channel is not shown here. The white frame indicates the segmental area used to quantify the number of sessile cells in Fig 3. D. The number of hemocytes in hemolymph from ird1 null (ird15/ird1𝛥vps15) larvae compared to heterozygous controls (+/ird1𝛥vps15) and larvae carrying Cg-GAL4 (Cg>) or Hml𝛥-Gal4 (Hml>) combined with either He-GAL4 (Hml>He>) or FB-GAL4 (Hml>FB>) drivers, alone or in combination with ird1IR. Box-plots show medians, quartiles and outliers of hemocyte numbers from 10 larvae per genotype. Significance values for differences as estimated by pairwise comparisons using Kruskal-Wallis ANOVA test. Non-significant differences are not indicated.
