SRC

MOLECULAR AND CELLULAR BIOLOGY, Jan. 2007, p. 120–134 0270-7306/07/$08.00⫹0 doi:10.1128/MCB.00815-06 Copyright © 2007, American Society for Microbiology. All Rights Reserved.

Vol. 27, No. 1

The Activity and Stability of the Transcriptional Coactivator p/CIP/SRC-3 Are Regulated by CARM1-Dependent Methylation䌤 Hina Naeem,1,2 Donghang Cheng,4 Qingshi Zhao,1 Caroline Underhill,1 Marc Tini,2,3 Marc T. Bedford,4 and Joseph Torchia1,2* Department of Oncology, London Regional Cancer Program,1 Department of Physiology and Pharmacology,2 and Department of Microbiology and Immunology,3 The University of Western Ontario, London, Ontario, Canada, and University of Texas M. D. Anderson Cancer Center, Department of Carcinogenesis, Smithville, Texas 78957 4 Received 8 May 2006/Returned for modification 18 June 2006/Accepted 5 October 2006

The transcriptional coactivator p/CIP(SRC-3/AIB1/ACTR/RAC3) binds liganded nuclear hormone receptors and facilitates transcription by directly recruiting accessory factors such as acetyltransferase CBP/p300 and the coactivator arginine methyltransferase CARM1. In the present study, we have established that recombinant p/CIP (p300/CBP interacting protein) is robustly methylated by CARM1 in vitro but not by other protein arginine methyltransferase family members. Metabolic labeling of MCF-7 breast cancer cells with S-adenosylL-[methyl-3H]methionine and immunoblotting using dimethyl arginine-specific antibodies demonstrated that p/CIP is specifically methylated in intact cells. In addition, methylation of full-length p/CIP is not supported by extracts derived from CARM1ⴚ/ⴚ mouse embryo fibroblasts, indicating that CARM1 is required for p/CIP methylation. Using mass spectrometry, we have identified three CARM1-dependent methylation sites located in a glutamine-rich region within the carboxy terminus of p/CIP which are conserved among all steroid receptor coactivator proteins. These results were confirmed by in vitro methylation of p/CIP using carboxyterminal truncation mutants and synthetic peptides as substrates for CARM1. Analysis of methylation site mutants revealed that arginine methylation causes an increase in full-length p/CIP turnover as a result of enhanced degradation. Additionally, methylation negatively impacts transcription via a second mechanism by impairing the ability of p/CIP to associate with CBP. Collectively, our data highlight coactivator methylation as an important regulatory mechanism in hormonal signaling. sion of p/CIP has been shown to initiate tumor development in mice (54). Biochemical and functional studies have shown that p/CIP functions as a bridging factor that promotes the assembly of transcriptional complexes essential for NR-mediated transactivation. This assembly is mediated by several domains within the p/CIP protein that are conserved in SRC-1 and GRIP/TIF2 (17). The amino terminus contains a highly conserved basic helix-loop-helix and Per/ARNT/SIM domain which functions as an interaction surface for a wide variety of proteins (24). The central region of the SRC proteins encodes the receptor interacting domain consisting of three leucine-rich motifs (also known as NR boxes) with the consensus amino acid sequence LXXLL (where X is any amino acid and L is leucine). The LXXLL motifs are responsible for making direct contact with liganded NRs (20, 37, 53, 55). The carboxy terminus of p/CIP contains two transcriptional activation domains (AD1 and AD2) which serve as interaction surfaces for the recruitment of two major classes of coactivators. AD1 interacts directly with the acetyltransferases CBP and p300 (8, 53) and with GCN5/ PCAF(1, 5, 27, 38). AD2 serves as an interaction surface for a second class of enzymatic proteins, known as protein arginine methyltransferases (PRMTs) (3). Eight mammalian PRMTs have been identified, although the coactivator arginine methyltransferase (CARM1/PRMT4), PRMT1, and, more recently, PRMT2 appear to be the most relevant with respect to signaling by NRs (28, 43). Cotransfection assays using transient or stably integrated reporter genes have shown that individual SRC proteins can synergize with histone acetyltransferases and methyltransferases to activate NR-dependent transcription

Nuclear hormone receptors are a superfamily of liganddependent transcription factors that mediate the effects of small lipophilic hormones such as estrogen and retinoic acid. Chromatin-based assays examining promoter occupancy of nuclear receptor (NR)-dependent genes have shown that transcriptional activation involves recruitment of a large repertoire of coactivators that interact with liganded NRs in a coordinated fashion (42). Among the first coactivators recruited in response to hormone are the steroid receptor coactivator (SRC) proteins that include the p300/CBP interacting protein (p/CIP), also known in human form as SRC-3/AIB1/ACTR/ RAC3/TRAM1 (2, 8, 32, 51, 53), steroid receptor coactivator 1 (SRC-1) (23, 41), and steroid receptor coactivator 2 (SRC-2), also known as GRIP1/TIF2 (22, 56). p/CIP is a well-established NR coactivator which has been shown to mediate the transcriptional effects of liganded NRs in a variety of contexts in vitro as well as in vivo (34, 53). Downregulation of p/CIP expression in intact cells has been shown to inhibit cell growth (35, 52, 65, 66), and the targeted disruption of the p/CIP gene in mice has demonstrated a requirement for p/CIP in mammary gland development as well as several nuclear receptordependent and -independent pathways (4, 30, 59, 61). Importantly, the human homologue of p/CIP is amplified in a percentage of breast and ovarian cancers (2), and overexpres* Corresponding author. Mailing address: Cancer Research Laboratories, London Regional Cancer Program, London, Ontario, Canada N6A 4L6. Phone: (519) 685-8692. Fax: (519) 685-8673. E-mail: jtorchia @uwo.ca. 䌤 Published ahead of print on 16 October 2006. 120

VOL. 27, 2007

METHYLATION OF A NUCLEAR RECEPTOR COACTIVATOR

(26, 50, 57). CARM1 and PRMT1 can methylate specific arginines on histones H3 and H4, respectively, and several studies have demonstrated a correlation between methylation of histone H3, recruitment of CARM1, and activation of several steroid-responsive genes (11). Disruption of the CARM1 gene in mice results in embryonic lethality (64), and estrogen receptor (ER)-dependent signaling is compromised in the CARM1 null cells. Collectively, these studies suggest that recruitment of CARM1 represents an essential activating step in mammalian gene transcription. The recent discoveries of lysine and arginine demethylases indicates that methylation, similar to acetylation (49, 58), represents a dynamic and reversible modification and adds another level of complexity to our understanding of transcriptional regulation. Importantly, arginine methylation is not restricted to posttranslational modification of histones. There is mounting evidence supporting the hypothesis that in addition to methylating histone H3, the physiological role of CARM1 may be dependent on methylation of nonhistone proteins. For example, CARM1 specifically methylates CBP/p300, and mutation of the methylation sites in CBP abolishes steroid-dependent transcriptional activation (10, 31, 62). In addition to histone H3 and p300/CBP, CARM1 methylates proteins involved at several other critical points in the transcriptional process including the poly(A)-binding protein (PABP1) (29), RNA binding molecules involved in transcript stability (HuR and HuD) (15), and the core splicing factor SmB (12). In the present study we have characterized the association between p/CIP and the methyltransferase protein CARM1. We demonstrate that the association between p/CIP and CARM1 occurs on target genes in response to hormone and is not detectable in solution following immunopurification of p/CIP. In addition, we show that p/CIP is a substrate for CARM1 in vitro and in vivo. Using a combination of mass spectrometry and molecular mapping, we have identified several CARM1-dependent methylation sites in p/CIP. At least three sites are found within a highly conserved glutamine-rich region of the carboxy-terminus of p/CIP, and additional sites are also located in the central region of p/CIP. Our results suggest that p/CIP methylation by CARM1 may have a dual role in regulating p/CIP function. First, arginine methylation appears to reduce protein stability and causes an increase in p/CIP turnover. Second, we demonstrate that arginine methylation represents a critical regulatory signal involved in coordinating the dissociation of CBP and p/CIP. Collectively, the results of our study suggest that arginine methylation represents an important posttranslational modification which may be important for regulating coregulator stability as well as the dynamics of nuclear receptor-mediated transcription. MATERIALS AND METHODS Plasmids and reagents. The cDNAs encoding full-length CARM1 were kindly provided by Michael Stallcup (University of California-Los Angeles), and PRMT1 cDNA was provided by Harvey Herschman (University of CaliforniaLos Angeles). The baculovirus vectors for p/CIP, p/CIP deletion mutants, CARM1, CBP, and PRMT1 were subcloned into a Fastbac vector using standard cloning techniques. For the Gal4 transfection assays, p/CIP fragments were generated by PCR using PCR Supermix High Fidelity (Invitrogen) and subcloned in frame into a PMgal (Stratagene) expression vector. Antibodies against CARM1 and CBP were purchased from Santa Cruz Biotechnologies. Antibody against human ER␣ was obtained from Bethyl Laboratories. Anti-p/CIP anti-

121

body was generated as previously described (44). The experiments shown in Fig. 3C and Fig. 7 were performed using an anti-SRC-3 antibody obtained from Bethyl Laboratories. ␣mR17 antibodies were purchased from UpState. The p/CIPR3A cDNA (containing substitutions of arginine to alanine at amino acids 1178, 1184, and 1195) and the p/CIPR6A (containing substitutions of arginine to alanine at amino acids 1163,1168, 1170, 1178,1184, and 1195) were generated by site-directed mutagenesis of p/CIP using a Quickchange kit (Stratagene) according to the manufacturer’s instructions. S-adenosyl-L-[methyl-3H]methionine ([3H]SAM) (80 Ci/mmol) was purchased from Amersham and [35S]methionine (419 mBq/ml) was purchased from Perkin Elmer. Biotin-labeled peptides were obtained commercially from Biosynthesis Incorporated. Cell lines and transfections. HeLa, COS-1, CV-1, MCF-7, U2OS, CARM1⫹/⫹, and CARM1⫺/⫺ mouse embryonic fibroblasts (MEFs) were maintained in Dulbecco modified Eagle medium (DMEM) supplemented with 10% fetal bovine serum (FBS), 0.1 U/ml penicillin G, and 0.1 ␮g/ml streptomycin sulfate in 5% CO2 at 37°C. To assess transcriptional activity of Gal4-p/CIP fusion proteins, transient transfections were performed using Lipofectamine 2000 according to the manufacturer’s instructions (Invitrogen). COS-1 cells were seeded at approximately 180,000 cells/well in 24-well plates. A total of 100 ng of the pMGal vector (cytomegalovirus) directing the expression of either the Gal4 DNA binding domain (DBD) alone and either p/CIP deletions or mutants fused in frame with Gal4 DBD were cotransfected with 250 ng of luciferase reporter plasmid containing five binding sites for Gal4 upstream of a minimal promoter. Renilla luciferase (0.5 ng) was used to monitor transfection efficiency, and total DNA was adjusted to 500 ng per well with pBKS vector. Forty-eight hours after transfection, cells were harvested, and cell extracts were prepared in 75 ␮l of 1⫻ reporter lysis buffer (Promega). Ten-microliter aliquots of the extract were used for subsequent determination of luciferase and Renilla activity according to the manufacturer’s instructions (Promega). Luciferase values were normalized to the output of the internal Renilla control plasmid, and the relative activation (n-fold) was calculated relative to the level of pMGal alone, which was arbitrarily set to 1. Luciferase activities are shown as the means and standard errors of at least three independent experiments performed in triplicates. To analyze the expression levels of Gal4 fusion proteins, 4 ␮g of each protein was transfected with Lipofectamine 2000 into COS-1 cells according to the manufacturer’s protocol (Invitrogen). Prior to transfection, COS-1 cells were seeded at 90% confluence in six-well plates. Forty-eight hours posttransfection, cells were harvested and lysed with radioimmunoprecipitation assay lysis buffer (50 mM Tris, pH 8.0, 1 mM EDTA pH 8.0, 150 mM NaCl, 0.1% sodium dodecyl sulfate [SDS], 1.0% NP-40, 0.5% sodium deoxycholate, and protease inhibitors). Bradford protein assays were performed to determine the concentration of whole-cell extracts. Twenty micrograms of each extract was subjected to SDSpolyacrylamide gel electrophoresis (PAGE) followed by Western blotting with anti-Gal antibody (Santa Cruz). Antitubulin antibody (Sigma) was used as loading control. To assess the significance of methylation in estrogen signaling, cells were maintained in phenol red-free DMEM supplemented with 10% charcoalstripped FBS for 48 h. A day before transfection, cells were seeded at ⬃75,000 cells/well in 24-well plates. Twenty-five nanograms of wild-type p/CIP and of p/CIPR6A cDNA was cotransfected with 200 ng of a luciferase reporter containing three copies of an estrogen response element (ERE) upstream of a minimal promoter and 10 ng of ER. For some experiments, increasing amounts of wild-type p/CIP or p/CIPR6A (50, 100, and 200 ng) were cotransfected with 200 ng of a pS2 luciferase reporter and 10 ng of ER. Total DNA was adjusted to 800 ng/well with empty vector, and transfections were performed using Lipofectamine 2000 according to the manufacturer’s protocol (Invitrogen). Twenty-four hours after transfection, cells were stimulated with 1 ␮M ␤estradiol for 16 h. Cells were lysed with 75 ␮l of 1⫻ reporter lysis buffer (Promega), and a 20-␮l aliquot of the whole-cell extract was used for luciferase activity analysis. Luciferase activities are shown as the means ⫾ standard errors of three independent samples. Immunoprecipitation, Western blot analysis, and fluorography. Cells were washed twice in phosphate-buffered saline (PBS), harvested, and lysed in lysis buffer (⬃300 ␮l/10-cm plate) consisting of 20 mM Tris (pH 7.9), 300 mM KCl, 0.1% NP-40, 10% glycerol, 0.1 mM dithiothreitol (DTT), 0.5 mM EDTA, 0.5 mM EGTA, and protease inhibitor cocktail. Extracts were then centrifuged for 10 min at 16,000 ⫻ g at 4 C, and the soluble extracts were retained. Samples were normalized for protein content, followed by the addition of the appropriate antibody for 2 h on ice. Samples were then diluted to 500 ␮l with lysis buffer, and 50 ␮l of a 50% slurry (vol/vol) of protein A/G agarose was added overnight with rocking. The antibody complexes were washed extensively with lysis buffer, and the bound complexes were separated by SDS-PAGE, transferred to nitrocellulose membrane, and blocked overnight in PBS containing 0.1% Tween 20 and

122

NAEEM ET AL.

5% nonfat dried milk. The appropriate antibodies were then diluted in blocking buffer, and the membrane was probed for 2 h at room temperature with rocking, followed by the appropriate secondary antibody for 1 h. Proteins were detected using enhanced chemiluminescence according to the manufacturer’s recommendations (Amersham). For experiments involving the analysis of 35S-labeled proteins, immunoprecipitated proteins were separated by SDS-PAGE and analyzed by fluorography. Gels were then treated with ENHANCE, dried, and exposed for several days to film. For the experiments shown in Fig. 3C and 7, cells were grown for 8 days in the presence of AdOx prior to immunoprecipitation of p/CIP. Purification and analysis of p/CIP. Nuclear extracts were dialyzed against buffer A (20 mM Tris [pH 7.9], 0.5 mM EDTA, 0.5 mM EGTA, 10% glycerol, 0.5 mM DTT, 0.2 mM phenylmethylsulfonyl fluoride, and 5 ␮g/ml of leupeptin, aprotinin, and pepstatin) containing 100 mM KCl. To purify p/CIP, the nuclear extract was loaded onto a P11 phosphocellulose column preequilibrated in the same buffer. The flowthrough was collected, and the column was washed sequentially with buffer A containing increasing concentrations of KCl. The 0.1 M fraction containing p/CIP was precipitated with 20 to 60% ammonium sulfate, and the precipitated proteins were resuspended in 4 ml of buffer A containing 100 mM KCl. This was then dialyzed against the same buffer to remove residual ammonium sulfate before the sample was applied to a Sephacryl S300 gel filtration column. The column was washed with buffer A at a flow rate of 0.4 ml/min. Fractions were collected, pooled, and analyzed for p/CIP by Western blotting. The p/CIP-containing fractions were pooled and dialyzed against buffer A containing 100 mM KCl. For immunoaffinity purification of p/CIP, affinity-purified p/CIP antibody was cross-linked to protein A-Sepharose using dimethylpalmilidate according to standard procedures (19). Fractions from the gel filtration step were pooled and precleared by passing the pooled fractions through a control affinity column containing anti-rabbit immunoglobulin G. The eluant was then loaded onto the anti-p/CIP affinity column at a flow rate of 0.2 to 0.5 ml/min. The flowthrough was collected and reloaded on the column five times prior to elution of the bound proteins with 100 mM glycine (pH 3.0). For mock-purification experiments, samples from the gel filtration step were loaded onto protein A-Sepharose cross-linked to an irrelevant antibody. Normally, protein samples were fractionated by SDS-PAGE and transferred to nitrocellulose membrane, and specific proteins were analyzed by Western blotting with the appropriate antibodies as indicated. For the purification of p/CIP from MEFs, cells were grown to confluence on 10- by 150-mm plates and harvested, and nuclear extracts were prepared as described above. Extracts were then passed directly through the anti-p/CIP immunoaffinity column as described above and then subjected to SDS-PAGE and Western blotting. Expression and purification of recombinant proteins. FLAG- or hemagglutinin-tagged proteins were generated using the Bac-to-Bac baculovirus expression system according to the manufacturer’s instructions (Invitrogen). Proteins were subcloned into the Fastbac expression vectors and transformed into DH10 bacteria. The resulting bacmids were transfected into Sf9 cells to produce recombinant baculovirus, which was amplified and used to infect Sf9 cells at a multiplicity of infection of 5. After 48 h, cells were lysed, and recombinant proteins were purified by immunoaffinity with anti-Flag M2 affinity resin essentially as described previously. After extensive washing, proteins were eluted with 20 mM Tris buffer, pH 7.9, 100 mM KCl, 10% glycerol, 0.5 mM EDTA, and 0.2 mg/ml of the appropriate peptide competitor. Proteins were then dialyzed against elution buffer without peptide, frozen, and stored at ⫺80 C. Glutathione S-transferase (GST) fusion proteins containing various regions of p/CIP were purified on glutathione agarose beads following standard procedures. Regions of p/CIP were subcloned into the pGEX bacterial expression vector in frame with the GST moiety, and the resulting plasmid was transformed into the Escherichia coli strain BL-21. The overnight culture was diluted 1:100 in 100 to 300 ml of selection medium and grown at 37°C with shaking until an optical density at 600 nm of ⬃0.5 was reached, at which time protein expression was induced with 1.0 mM isopropyl-␤-D-thiogalactopyranoside (final concentration) for 5 h at room temperature. Cells were pelleted by centrifugation at 4°C for 10 min at 10,000 ⫻ g and resuspended in 10 ml of resuspension buffer per 100 ml of starting culture volume prior to incubation on ice for 30 min with occasional mixing. The resuspended cells were then lysed by sonication prior to centrifugation of the samples at 4°C for 1 h at 30,000 ⫻ g. A total of 500 ␮l of GST-Sepharose beads prewashed in resuspension buffer was added to the clarified supernatant, and the samples were incubated at 4°C with rocking for 1 h. The beads were pelleted by centrifugation at 4°C for 2 min at 1000 rpm and subsequently washed five times with 12 ml of resuspension buffer. The beads were resuspended in 1 ml of resuspension buffer containing 10 mM reduced glutathione and incubated for 5 min with rocking. The supernatants containing the eluted proteins were dialyzed against a buffer consisting of 20 mM Tris, pH

MOL. CELL. BIOL. 7.9, 100 mM KCl, 10% glycerol, 0.5 mM EDTA, and 0.5 mM DTT and stored at ⫺80°C. Methylation assays. In vitro methylation reactions were performed using 0.2 to 1 ␮g of either purified proteins or biotinylated peptides as substrates and 100 ng of purified CARM1 protein. Reactions were performed at 30°C for 1 h in 20 ␮l (final volume) of reaction buffer consisting of 50 mM Tris-HCl, pH 8.5, 20 mM KCl, 10 mM MgCl2, 1 mM ␤-mercaptoethanol, and 0.1 M sucrose and 5 ␮Ci of [3H]SAM. Upon completion of the methylation reactions, biotin-labeled peptides were purified with MagnaSphere streptavidin beads (Promega) for 1 h at 4°C with rotation. Beads were washed three times with wash buffer (50 mM Tris, pH 8, 150 mM NaCl, 5 mM EDTA, 0.5% NP-40), and radioactivity was measured by scintillation counting. For in vivo labeling of methylated proteins, MCF-7 cells were grown for 24 h in DMEM without methionine and containing stripped serum, followed by the addition of L-[methyl-3H]methionine (50 ␮Ci/ml) for 1 h. Cells were then harvested, lysed, and p/CIP immunopurified as previously described (36). To analyze methylation of p/CIP by mass spectrometry, a 100-ml culture of Sf9 cells (1.5 ⫻ 106 cells/ml) was infected with FLAG-p/CIP baculovirus alone or coinfected with FLAG-CARM1. At 48 h postinfection, the cells were harvested and resuspended in a 50 mM Tris buffer (pH 7.9) containing 300 mM KCl and 0.1% NP-40 and disrupted by 10 strokes with a dounce homogenizer; the cell lysate was then clarified by centrifugation at 100,000 ⫻ g for 30 min. To each of the cell extracts, anti-FLAG-agarose was added and incubated for 2 h at 4 C; cells were washed extensively with lysis buffer, with a final wash with buffer containing 100 mM KCl and 0.1% NP-40. The bound proteins were eluted with buffer containing 1.0 mg/ml FLAG peptide, and the coimmunopurified complexes were separated by SDS-PAGE. The 160-kDa band corresponding to p/CIP was excised and analyzed by mass spectrometry (MS) performed at the Southern Alberta Mass Spectrometry Center (Calgary, Alberta, Canada). Chromatin immunoprecipitation (ChIP). MCF-7 cells grown in phenol redfree DMEM containing 10% charcoal-stripped FBS for 48 h prior to stimulation with 10⫺7 M ␤-estradiol for the time periods indicated in Fig. 1C. Cells were then cross-linked with 1% formaldehyde at room temperature for 10 min. Crosslinking was terminated by adding glycine to a final concentration of 125 mM and incubating for 5 min. Cells were washed twice with ice-cold PBS containing 0.5 mM EDTA and harvested. Cells pellets were lysed in 0.3 ml of cell lysis buffer (50 mM Tris-HCl [pH 8.1], 10 mM EDTA, 1% SDS, and protease inhibitors) and incubated on ice for 10 min. Cell lysates were sonicated to yield DNA fragments ranging in size from 300 to 1,000 bp. Supernatants were diluted 10-fold in dilution buffer (20 mM Tris-HCl [pH 8.1], 1% Triton X-100, 2 mM EDTA, 150 mM NaCl, and protease inhibitors) and precleared with 60 ␮l of a 50% slurry of protein A-Sepharose containing 2.5 ␮g of sheared salmon sperm DNA for 2 h at 4°C. Immunoprecipitation was performed overnight at 4°C with 1.5 to 4 ␮g of the antibodies. A total of 60 ␮l of protein A-Sepharose containing 2.5 ␮g of salmon sperm DNA per ml was added to the solution and incubated for 1 h at 4°C. The beads were washed one time with buffer A (20 mM Tris-HCl [pH 8.1], 150 mM NaCl, 2 mM EDTA, 0.1% SDS, 1% Triton X-100), four times with cold buffer B (20 mM Tris-HCl [pH 8.1], 500 mM NaCl, 2 mM EDTA, 0.1% SDS, 1% Triton X-100), and one time with LiCl-detergent buffer (10 mM Tris-HCl [pH 8.1], 0.25 M LiCl, 1% NP-40, 1% deoxycholate, 1 mM EDTA). Finally, the samples were washed three times with Tris-EDTA buffer. Immunocomplexes were extracted twice with 200 ␮l of elution buffer (1% SDS–0.1 M NaHCO3). NaCl was added to a final concentration of 200 mM, and the cross-linking was reversed by heating at 65°C overnight. The protein was digested by adding Tris (pH 6.5) to a final concentration of 40 mM and 20 ␮g of proteinase K and incubating at 45°C for 1 h. The DNA was purified using QIAGEN PCR purification spin columns. PCR was performed using primers specific to the human pS2 promoter consisting of the forward primer 5-GGCCATCTCTCACTATGAATCATTCTGC-3⬘ and the reverse primer 5⬘-GGCAGGCTCTGTTTGCTTAAAGAGCG-3⬘. PCR conditions were as follows: initial denaturing cycle of at 94°C for 3 min, followed by 35 cycles of 94°C for 30 s, 52°C for 30 s, and 72°C for 1 min, with a final elongation step of 72°C for 10 min. The PCRs were quantified by scanning densitometry. Pulse-chase labeling experiments. MEFs were grown to approximately 80% confluence and grown in DMEM methionine-cysteine-free medium for 1 h and then replaced by medium containing methionine for 40 min. Cells were then washed twice in PBS and incubated with medium containing 2 mM cold methionine-cysteine. Cells were harvested at the indicated times (see Fig. 6C and D), and p/CIP was immunoprecipitated from the cell lysates using p/CIP antibody. For cells overexpressing p/CIP, 2- by 15-cm plates were transfected with 10 ␮g of cDNA for 24 h. The transfected cells corresponding to each cDNA were pooled, replated (3 ⫻ 106 cells/10-cm plate), and allowed to adhere overnight, and pulse-chase experiments were performed the following day as described above.

VOL. 27, 2007


123

FIG. 1. CARM1 associates with p/CIP on DNA. (A) HeLa nuclear extracts were separated by gel filtration chromatography, and fractions were assayed by immunoblotting using the antibodies indicated on the left. (B) Fractions corresponding to peaks I and II shown in panel A were pooled and passed through an anti-p/CIP immunoaffinity column or immunoglobulin G (IgG) column as control. After extensive washing, bound proteins were eluted using low pH buffer and assayed by immunoblotting using antibodies specific for p/CIP, CBP, or CARM1. (C) p/CIP and CARM1 bind to the endogenous PS2 promoter in vivo. ChIP analysis of the PS2 promoter in MCF-7 cells using antibodies against p/CIP and CARM1 demonstrates that both p/CIP and CARM1 are recruited to the PS2 promoter in response to estradiol. MCF-7 cells were stimulated for various time periods. Cells were fixed, and sequential ChIPs were performed using an anti-p/CIP antibody, followed by reimmunoprecipitation (ReChIP) using a CARM1-specific antibody. Samples were analyzed by PCR using specific primers flanking the PS2 promoter, and the relative abundance was quantified by densitometry.

RESULTS Target gene assembly of p/CIP and CARM1 coactivator complexes. CARM1 was initially identified based on its ability to interact with the carboxy terminus of GRIP1 (7) and has also been purified as a component of a large multiprotein complex from MCF-7 cells(63). To determine if p/CIP and CARM1 are stably associated in solution, we performed biochemical purification experiments of p/CIP and CARM1 using HeLa nuclear extracts. Gel filtration chromatography of nuclear extracts followed by Western blotting indicated that

p/CIP could be found in two chromatographically distinct peaks, a large peak corresponding to a size of approximately 1 MDa and a second, more abundant peak, migrating at approximately 600 kDa (Fig. 1A). Interestingly, CARM1 was identified as a broad peak partially overlapping with the smaller 600-kDa p/CIP component, whereas CBP was found in fractions corresponding to the larger 1-MDa peak. Fractions corresponding to each peak were pooled and purified using an anti-p/CIP affinity column. Immunoblotting of the affinity-purified p/CIP complexes indicated that CBP was associated with

124

NAEEM ET AL.

FIG. 2. In vitro methylation of p/CIP. (A) Epitope-tagged recombinant proteins were generated in Sf9 cells using baculovirus. Cells were then harvested, and proteins were immunopurified using anti-FLAG Sepharose. Approximately 500 ng of various purified proteins was then analyzed by SDS-PAGE and Coomassie blue staining. (B) Approximately 500 ng of purified recombinant CBP, p/CIP, or specific histones was incubated in the presence of 100 ng of either CARM1 or PRMT1 and [3H]SAM for 1 h. Proteins were then separated by SDS-PAGE and analyzed by fluorography. (C) In vitro methylation assays were performed using 500 ng of p/CIP, 100 ng of recombinant CARM1, and increasing concentrations of histones as indicated at the top of the panel. The reactions were terminated, proteins were separated by SDS-PAGE, and methylation of p/CIP was monitored by fluorography. BSA, bovine serum albumin.

p/CIP purified from the larger 1-MDa component (Fig. 1B). In contrast, CARM1 was not retained by the anti-p/CIP affinity column but was detected entirely in the flowthrough component of the 600-kDa (data not shown) fraction, suggesting that

MOL. CELL. BIOL.

CARM1 and p/CIP do not stably associate in solution in HeLa cells. We also used ChIP to assess if p/CIP and CARM1 associate at the PS2 promoter in response to hormone (Fig. 1C). Following stimulation with estradiol, the cells were fixed with formaldehyde, and chromatin was immunoprecipitated with a p/CIP antibody, followed by an immunoprecipitation using a CARM1-specific antibody. These results indicate that both p/CIP and CARM1 associate with the PS2 promoter in a hormone-dependent manner, with a peak occurring at approximately 30 min, which is consistent with earlier observations (38, 47). Collectively, these results establish that the association between CARM1 and p/CIP occurs on target genes in the context of chromatin and that they most likely do not form a stable complex in solution. p/CIP is a substrate for CARM1-dependent methylation. Recent studies have shown that CARM1 is capable of methylating nonhistone proteins, such as CBP, resulting in concomitant changes in transcriptional regulation (10, 28, 62). Based on the direct association between p/CIP and CARM1, we assessed whether p/CIP may also serve as a substrate for CARM1. In vitro methylation assays using purified proteins (Fig. 2A) indicated that both p/CIP and CBP are robustly methylated by CARM1 (Fig. 2B). The p/CIP methylation is directly dependent on the methyltransferase activity of CARM1 as a point mutation that abolishes methyltransferase activity was incapable of methylating either p/CIP or CBP (not shown). In contrast, neither p/CIP nor CBP is methylated by the related family member PRMT1 (Fig. 2B). Furthermore, the addition of increasing amounts of free histones in the methylation reaction had no effect on p/CIP methylation, suggesting that p/CIP serves as a very efficient substrate for CARM1 (Fig. 2C). To further define the specificity of the methylation reaction, we utilized whole-cell extracts from MEFs isolated from CARM1 null mice as a source of methyltransferase activity. Purified recombinant p/CIP could not be methylated in vitro using extracts from CARM1⫺/⫺ MEFs, indicating that that no alternative pathway exists for p/CIP methylation (Fig. 3A). Experiments were also performed to assess whether p/CIP was specifically methylated in intact cells. First, MCF-7 cells were metabolically labeled with [3H]SAM, followed by immunoprecipitation using a p/CIP antibody. The results of the fluorographic image indicated specific incorporation of the radioisotope into the immunoprecipitated p/CIP protein (Fig. 3B). Second, p/CIP was immunoprecipitated from cells grown in the absence or presence of the methylation inhibitor periodate oxidized adenosine (AdOx). The immunoprecipitated proteins were then immunoblotted with p/CIP antibody or with an antibody which specifically recognizes asymmetric dimethylarginines found on arginine 17 of histone H3 (␣mR17). The antibody, ␣mR17, has previously been shown to not only recognize the methylated H3 but also display immunoreactivity with a number of other proteins in a CARM1-dependent fashion (64). Both the anti-p/CIP antibody and the ␣mR17 antibody were able to recognize the immunoprecipitated p/CIP protein (Fig. 3C). However, for cells grown in the presence of AdOx, a significant decrease in immunoreactivity was detected using the ␣mR17. Taken together, these results establish that p/CIP is a substrate for CARM1-dependent methylation both in vitro and in intact cells.

VOL. 27, 2007


FIG. 3. p/CIP is methylated in intact cells. (A) Extracts from CARM1⫺/⫺ MEFs do not support methylation of p/CIP in vitro. Approximately 500 ng of purified recombinant p/CIP protein was incubated with extracts derived from either CARM1⫹/⫹ or CARM1⫺/⫺ MEFs in the presence of [3H]SAM. Methylation reactions were then analyzed by SDS-PAGE and fluorography. (B) MCF-7 cells were labeled for 1 h with L-[methyl-3H]methionine (50 ␮Ci/ml) for 1 h, followed by cell lysis and immunoprecipitation of p/CIP (36). The complexes were then separated by SDS-PAGE and analyzed by fluorography. (C) MCF-7 cells were grown in the presence and absence of AdOx (20 ␮M) for 8 days, and p/CIP was immunoprecipitated. The immunoprecipitated complexes were separated by SDS-PAGE and probed with either an anti-p/CIP antibody (␣p/CIP) or an antibody raised against dimethylated arginine 17 on histone H3 (␣mR17).

CARM1-dependent methylation sites are found in the carboxy terminus of p/CIP. To identify the specific amino acids methylated by CARM1, we overexpressed p/CIP, alone or in combination with CARM1, in Sf9 cells using a baculovirus expression system. Forty-eight hours after infection, p/CIP was affinity purified, isolated by SDS-PAGE, and analyzed by matrix-assisted laser desorption ionization–time of flight MS. The masses of 15 peptides were identified and found to match the predicted peptide masses of p/CIP. Four were identified with increased masses, consistent with the presence of dimethyl groups (Table 1). Three of the peptides were found to contain low levels of an arginine dimethylated form, regardless of the

125

presence of CARM1. Significantly, it was found that the relative abundance of the methylated form of a peptide corresponding to amino acids (aa) 1176 to 1201 of p/CIP was directly correlated with the coexpression of CARM1. This peptide was then analyzed further by liquid chromatographytandem MS, and it was determined that the arginines located at positions 1178, 1184, and 1195 were all asymmetrically dimethylated in a CARM1-dependent manner. To validate the results obtained by MS, C-terminal truncation mutants of p/CIP were generated using baculovirus, purified, and tested as substrates for methylation by CARM1 in vitro (Fig. 4 A). Whereas a fragment spanning residues 1 to 1398 was strongly methylated, deletion of residues 1085 to 1398 dramatically decreased methylation. This is consistent with the indicated sites of methylation determined by MS. In addition, we also employed biotinylated synthetic peptides as substrates for in vitro methylation reactions. The peptides were bound to streptavidin-coated beads, washed, and analyzed by liquid scintillation counting. The peptide corresponding to aa 1176 to 1201, which contained the CARM1-dependent methylation sites identified by MS, was robustly methylated in vitro (Fig. 4B). Further inspection of this region indicated the presence of three additional arginines at aa 1163, 1168, and 1170 which lie immediately N-terminal to the region identified by MS. Although not identified by MS, in vitro methylation reactions using a synthetic peptide indicated that this region is also methylated by CARM1 in vitro (Fig. 4B). Finally, mapping studies were performed using recombinant GST proteins fused to regions of p/CIP spanning the full-length protein. Using the GST fusion proteins as substrates, two additional regions of p/CIP, corresponding to aa 819 to 853 and 920 to 968, were found to serve as highly efficient substrates for CARM1 in vitro (Fig. 5A). Further mapping using biotinylated peptides indicated that aa 844 to 865, containing arginines at aa 839 and 844, was robustly methylated by CARM1 in vitro (Fig. 5B). A second peptide containing an arginine at aa 961 was also methylated, although to a lesser degree. To determine which arginine is specifically methylated within aa 844 to 865, individual arginines were mutated to alanine. Mutation of the amino acid at position 839 completely abolished CARM1-dependent methylation, whereas mutation of arginine to alanine at aa 844 diminished methylation by approximately 50%, suggesting that arginine 844 may be involved in substrate recognition by CARM1 (Fig. 5C, center panel). Collectively, the results of our biochemical analysis indicate two methylated regions in p/CIP: methylation domain 1 (MD1) stretching from R1163 to R1195 and MD2 stretching from R839 to R961. Phosphorylation at S847 antagonizes p/CIP methylation. Amino acids at positions 839 and 844 are found directly adjacent to a region of p/CIP containing several conserved serines, at aa 847 and 850, which have recently been identified as physiologically relevant phosphorylation sites (60). The proximity of these phosphorylation sites to R839 suggests a potential for cross talk between methylation and phosphorylation of p/CIP. To test this hypothesis, we generated a peptide phosphorylated at aa 847 which has been shown to be phosphorylated by I␬B kinase in response to hormone treatment (60). Phosphorylation at aa 847 decreased the methylation at aa 839 by approximately fivefold, indicating that prior phosphorylation antagonizes methylation at aa 839 in vitro (Fig. 5C, right panel).

126

NAEEM ET AL.

MOL. CELL. BIOL.

TABLE 1. Matrix-assisted laser desorption ionization–time of flight MS analysis of p/CIPa Peptide no.

Observed mass (Da)

Predicted mass (Da)

Residues (aa)

Sequence

Modification (no. of asymmetric di-Met arginines)b

1 2 3 4

1,619.83 3,687.78 3,124.38 3,140.43

1,618.82 3,686.78 3,123.37 3,139.50

192–204 315–346 1176–1201 1202–1229

KAPYILIVRMLMK RHQEAYVHGHAETPVYRFSLADGTIVSAQTK QLRMQLQQRLQGQQFLNQSRQALEMK MENPAGTAVMRPMMPQAFFNAQMAAQQK

1 2 3c 1

a These peptides in p/CIP were identified by matrix-assisted laser desorption ionization–time of flight MS analysis as showing asymmetric dimethylation. For each peptide, the expected mass is the predicted mass containing the corresponding arginine modification indicated in the last column. The presence of each modification indicated was confirmed based on the similarities between the observed and predicted masses. b di-Met, dimethylated. c Methylation of residues 1176 to 1201 in p/CIP was highly dependent on CARM1 coexpression. Asymmetric dimethylation of R1178, R1184, and R1195 within residues 1176 to 1201 was then confirmed using tandem MS.

p/CIP turnover is regulated by methylation. To investigate the functional relevance of p/CIP methylation of the carboxy terminus (MD1), we generated substitutions of arginine to alanine at R1178, R1184, and R1195, yielding (p/CIPR3A, and at R1163, R1168, R1170, R1178, R1184, and R1195, yielding p/CIPR6A. Methylation reactions using purified recombinant p/CIP3A and p/CIP6RA proteins indicated a significant decrease in CARM1-dependent methylation in vitro (Fig. 6A). Surprisingly, transient expression of the methylation site mutants in COS-1 cells consistently yielded higher protein levels compared to wild-type p/CIP, suggesting that methylation of p/CIP may play a role in p/CIP turnover (Fig. 6B). This was also reflected in the amount of mutant protein immunoprecipitated relative to wild-type p/CIP. In order to examine the effect of CARM1-mediated methylation on p/CIP stability, we conducted pulse-chase experiments in CARM1⫺/⫺ and CARM1⫹/⫹ MEFs. Cells were labeled with [35S]methionine for 40 min and then chased with cold methionine for various time periods, followed by immunoprecipitation of endogenous p/CIP and analysis by immunoblotting and fluorography. The level of radiolabeled p/CIP relative to the total cellular pool was substantially reduced at 8 h in CARM1⫹/⫹ cells, while no noticeable reductions were observed in CARM1⫺/⫺ cells (Fig. 6C). These results suggest that the turnover of p/CIP in the CARM1 wild-type cells was significantly faster, consistent with the notion that methylation affects protein stability. To determine whether this effect is directly dependent on the amino acid residues recognized by CARM1, pulse-chase experiments were also conducted using cells transfected with p/CIP mutants. Cells were transfected with either p/CIP or p/CIPR6A, and after 24 h cells were replated and labeled with [35S]methionine. In agreement with the above data, the stability of the mutant was significantly increased compared to wild-type p/CIP (Fig. 6D). To examine if p/CIP turnover is directly dependent on CARM1 methylation, MCF-7 cells were grown in the presence of AdOx to hypomethylate p/CIP; subsequently, p/CIP was immunoprecipitated and incubated with extracts derived from CARM1⫺/⫺ or CARM1⫹/⫹ MEFs, in the presence of SAM, for various time periods, followed by immunoblotting with p/CIP antibody. A dramatic reduction in p/CIP protein levels was observed following incubation with extracts derived from the CARM1 wild-type MEFs (Fig. 7). In contrast, p/CIP incubated with CARM1⫺/⫺ extracts was relatively resistant to degradation. These results suggest that

CARM1-dependent methylation may be required for p/CIP turnover. CARM1 dependent methylation regulates CBP association. To determine a functional role of p/CIP methylation, we examined the effects of p/CIP on transcriptional activity by the estrogen receptor. Transient transfection assays in COS-1 cells were performed using a reporter vector containing three copies of an ERE upstream of a minimal promoter, as well as the PS2 proximal promoter-driven luciferase gene. Transfection of limiting amounts of wild-type p/CIP resulted in a slight increase in transcriptional activity of the ERE luciferase in the presence of ␤-estradiol (Fig. 8A). In contrast, an equivalent concentration of p/CIPR6A mutant resulted in a significantly larger response in all cell types examined. An enhanced transcriptional response by the p/CIPR6A mutant was more evident on the PS2 promoter. Overexpression of wild-type p/CIP resulted in an approximately 2.8-fold increase in activity, whereas transfection of the p/CIPR6A mutant resulted in a concentration-dependent effect with an additional threefold increase in luciferase activity relative to the wild type (Fig. 8A). These results suggest that a lack of p/CIP methylation may cause p/CIP to accumulate within the cell, which in turn results in enhanced transcription in response to ␤-estradiol. We also examined the transcriptional activity of various regions of p/CIP fused to the Gal4 DBD. p/CIP (aa 819 to 1160) contains the major activation domain (AD1), which overlaps directly with the CBP/p300 interaction domain, but does not include the MD1 (5). When expressed in COS-1 cells, this Gal fusion produced a robust transcriptional response (Fig. 8B). Surprisingly, extension of this construct to include the MD1 (aa 819 to 1215) resulted in a dramatic reduction in transcriptional activity, indicating that this region may impart a negative regulatory influence on p/CIP-mediated transcriptional activation. Analysis of Gal4-p/CIP (aa 1158 to 1215) encompassing the MD1 alone revealed no significant transcriptional activity. Experiments were also performed using the entire carboxy terminus of p/CIP fused to Gal4 (aa 819 to 1398) containing point mutations in the MD1, which should prevent (Fig. 8B, lower panel) the effects on transcriptional activity imparted by methylation. Remarkably, these mutants displayed increased transcriptional activity when overexpressed in COS-1 cells, consistent with the effects obtained on the ERE-driven reporter constructs. However, under these conditions we did not observe significant differences in expression of the various Gal4 fusion proteins. These results suggest that the reduced

VOL. 27, 2007


127

FIG. 4. Molecular mapping of CARM1-dependent methylation of p/CIP. p/CIP truncation mutants were generated using a baculovirus system and purified by immunoaffinity chromatography. Approximately 500 ng of the various truncation mutants was then tested as a substrate for CARM1 by in vitro methylation assay using 100 ng of purified CARM1. On the left is the Coomassie-stained gel of the purified proteins resolved on an 8% SDS-PAGE gel, and on the right is the corresponding fluorograph. (B) One microgram of biotinylated peptides corresponding to the regions of p/CIP indicated was used as a substrate, and the incorporation of [3H]SAM was measured by in vitro methylation in the presence of purified CARM1. The asterisk indicates the three dimethylated arginines identified by mass spectrometry. (C) Homology of MD1 within the SRC family of proteins. SRC3 corresponds to the human homologue of p/CIP. The shaded areas indicate conserved arginines, and asterisks indicate arginines identified by mass spectrometry in p/CIP.

transcriptional activity associated with methylation is not simply a result of increased p/CIP degradation but that the methylation may affect activity by an additional mechanism. The effects of p/CIP methylation on transcription and the proximity of the methylation sites to the CBP/p300 interaction domain suggested that methylation may regulate the association with CBP. To investigate this possibility, we prepared nuclear extracts from both wild-type and CARM1⫺/⫺ MEFs

and purified endogenous p/CIP protein complexes using an immunoaffinity column. Initial experiments indicated that p/CIP levels were elevated in the CARM1⫺/⫺ MEFs by approximately twofold (Fig. 9A). In order to compensate for the increase in p/CIP levels, the amount of starting material in the input was normalized so that each had approximately the same amount of p/CIP, based on Western blotting. Immunoblotting of the purified proteins with a CBP-specific antibody indicated

128

NAEEM ET AL.

MOL. CELL. BIOL.

FIG. 5. Phosphorylation at S847 antagonizes methylation of p/CIP at R839. (A) GST recombinant proteins containing various regions of p/CIP spanning the full-length protein were generated in bacteria, purified, and used as substrates (500 ng) for purified CARM1 (100 ng) by in vitro methylation. At left is a Coomassie-stained gel of the GST fusion proteins used in the methylation assay resolved on a 12% SDS-PAGE gel, and at right is the corresponding fluorograph of the in vitro methylation reactions. (B) Comparison of the MD2 domains between p/CIP and SRC3. The asterisk corresponds to the phosphorylation site at aa 847. The shaded areas contain the methylation sites defined by in vitro methylation reactions using recombinant GST proteins. (C) Biotinylated peptides corresponding to the regions P1, P2, and P3 (shaded areas in panel B) were used as substrates, and the incorporation of [3H]SAM was measured by in vitro methylation in the presence of purified CARM1. Peptides corresponding to P1R839A and P1R844A contain substitutions of arginine to alanine. The peptide P1S847(p) is identical to P1 but contains a phosphorylated serine at aa 847.

that the amount of CBP stably associated with p/CIP is significantly enhanced in the CARM1 knockout MEFs (Fig. 9B). Indeed, in the wild-type MEFs, CBP was not detectable in the purified p/CIP complexes. These results indicate that in the absence of CARM1, the association between p/CIP and CBP is facilitated. DISCUSSION Previous overexpression studies in intact cells and in vitro reconstitution assays using chromatinized templates have

shown that CARM1 can interact and synergize with both p/CIP and CBP/p300 to activate NR-mediated transcription (6, 26, 62). This synergy is dependent on the methyltransferase activity of CARM1 and has been attributed to the ability of CARM1 to methylate specific arginines on histone H3 tails (50). Our data suggest that recruitment of CARM1 by p/CIP may play a more complex role in transcription than previously anticipated. In the present study we demonstrate that the transcriptional coactivator p/CIP/SRC-3 is methylated by CARM1. Using mass spectrometric analysis, we have shown that the predominant CARM1-dependent methylation sites in p/CIP

VOL. 27, 2007


129

FIG. 6. The relative abundance of p/CIP is regulated by arginine methylation. Epitope-tagged recombinant wild-type p/CIP (wt), or p/CIP mutants containing arginine substitutions at CARM1 methylation sites (p/CIPR3A or p/CIPR6A) were generated in Sf9 cells using baculovirus. Cells were then harvested, and proteins were immunopurified using anti-FLAG-Sepharose. Approximately 1 ␮g of each purified protein was analyzed by SDS-PAGE and Coomassie blue staining (left) and used as substrates for in vitro CARM1-dependent methylation reactions (right). (B) COS-1 cells were transfected with expression vectors for wild-type p/CIP (wt), p/CIPR3A, or p/CIPR6A. After 24 h cells were lysed, and whole-cell extracts were prepared. Equal amounts of protein from each extract were then analyzed by Western blotting using an anti-FLAG antibody for p/CIP or anti-tubulin antibody (left). Transfected samples were immunopurified using anti-FLAG-Sepharose, followed by immunoblotting with anti-FLAG antibody (right). (C) CARM1⫺/⫺ or CARM1⫹/⫹ MEFs were incubated with [35S]methionine for 40 min, followed by incubation with nonradioactive methionine-containing medium for the indicated time periods. Cells were then lysed, and p/CIP was immunoprecipitated and then subjected to SDS-PAGE and fluorography. (D) U2OS cells were transfected with either p/CIP wild-type or p/CIP R6A mutant. After 24 h, cells were incubated with [35S]methionine for 40 min and then incubated with cold methionine-containing medium for the indicated time periods. Cells were then lysed, and p/CIP was immunoprecipitated using anti-FLAG-Sepharose and then subjected to SDS-PAGE and fluorography. Samples were quantified by densitometry and expressed as a percentage of p/CIP remaining normalized to time zero.

130

NAEEM ET AL.

MOL. CELL. BIOL.

FIG. 7. Methylation of p/CIP is associated with increased degradation. HeLa cells were grown in the presence of AdOx for 8 days, followed by immunoprecipitation of p/CIP. Equal concentrations of p/CIP were then incubated with extracts from CARM1⫹/⫹ or CARM1⫺/⫺ MEFs in the presence of SAM for the indicated time periods. Reactions were then terminated and analyzed by Western blotting using anti-p/CIP antibody. The graph on the right indicates the relative amounts of p/CIP remaining, based on densitometry.

are localized to a glutamine-rich region in the carboxy terminus, which we refer to as MD1. PRMT1, a related methyltransferase, has also been shown to synergize with SRC and CBP/p300 proteins to activate NR signaling in transient transfection assays (26). The substrate specificity of CARM1 and PRMT1 is different, suggesting that the mechanism of coactivation of these two related methyltransferases may also differ (50). Indeed, our data suggest that PRMT1 is unable to methylate p/CIP in vitro, suggesting that p/CIP is a specific substrate for CARM1. Additionally, p/CIP could not be methylated in vitro by extracts derived from CARM1⫺/⫺ MEFs which still express PRMT1. This indicates that CARM1 is required for methylation of p/CIP in vivo. Importantly, immunoprecipitation of p/CIP from cell extracts, followed by Western blotting using the ␣R17H3 antibody which recognizes a dimethylated CARM1 recognition site on histone H3, clearly recognized methylated p/CIP. Taken together, these results, in conjunction with the mass spectrometry data, demonstrate that p/CIP is a direct substrate for CARM1 in vivo. By in vitro mapping experiments we have also identified a second region in p/CIP that can be methylated (R839 and R961) which we refer to as MD2. Although methylation of MD2 is extremely robust using peptide substrates and recombinant GST proteins, the functional significance of this finding is currently unclear as we did not detect methylation at this site using MS. Furthermore, deletion of MD2 did not have a significant impact on overall methylation of p/CIP. Our inability to detect methylation at R839 through mass comparisons may be due to the fact that R839 in Sf9 cells is already occupied by methyl groups and would not be accessible to CARM1-dependent methylation in Sf9 cells or in vitro using baculovirusgenerated protein. Additionally, we have shown that phosphorylation of S847 antagonizes methylation at R839. This finding is significant as this site has recently been shown to be phosphor-

ylated on endogenous SRC-3 and is functionally required for coactivation in response to hormonal signaling (60). Perhaps p/CIP produced in Sf9 cells may already be phosphorylated at S847, which may render R839 or R844 inaccessible to subsequent methylation by CARM1. A major finding of this study is that methylation regulates the stability of p/CIP. p/CIP mutants containing substitutions of arginine to alanine accumulate to a much greater degree when overexpressed in various cell types compared to wildtype p/CIP. A significantly higher concentration of p/CIP was also detected in the CARM1⫺/⫺ MEFs relative to the wildtype MEFs. This finding is also reflected in the pulse-chase experiments, which indicate that the methylation status of p/CIP is an important determinant regulating its stability, both in the CARM1⫺/⫺ MEFs and in cells expressing p/CIP methylation site mutants. Furthermore, we demonstrate that reconstituting hypomethylated p/CIP with extracts derived from wild-type MEFs resulted in a more rapid degradation of p/CIP compared to reconstitution of p/CIP using CARM1⫺/⫺ MEF extracts. These results suggest that the methylation status of p/CIP may serve as a prerequisite for rapid degradation. A critically unanswered question is the mechanism through which methylation affects p/CIP stability. Studies have shown that arginine methylation promotes protein-protein interactions in a variety of signal transduction pathways (3). Thus, one possibility is that methylation of p/CIP by CARM1 allows specific proteins to interact selectively with p/CIP, which, in turn, facilitates proteolytic degradation. An additional finding in this study is that p/CIP methylation may play a role in the transcriptional process by regulating complex assembly. This assertion is based on the observation that extension of the carboxy terminus AD1 to include the MD1 resulted in a significant decrease in transcriptional activity when tethered to the Gal4 DBD. Conversely, mutation of the CARM1 recognition sites to nonmethylatable alanines en-

VOL. 27, 2007


131

FIG. 8. p/CIP methylation is associated with decreased transcriptional activity. (A) COS-1 cells were transfected with expression plasmids containing ER (10 ng), full-length wild-type p/CIP (10 ng), or p/CIPR6A (10 ng) cDNAs, along with reporter plasmids (200 ng) containing three copies of an estrogen response element (ERE3Luc) or the PS2 proximal promoter (PS2Luc). Cells were stimulated with 10⫺6 M estradiol overnight and lysed on the following day, and luciferase activity was measured as described in Materials and Methods. (B) COS-1 cells were transfected with various regions of p/CIP fused to the Gal4 DBD along with a luciferase reporter plasmid containing five Gal4 binding sites. After 24 h, cells were lysed, and luciferase activity was measured. The corresponding Western blots shown on the right of each graph compare the relative levels of expression from the transfected Gal4 fusion cDNAs with the expression of antitubulin used as a loading control. NRID, nuclear receptor interaction domain; wt, wild type.

132

NAEEM ET AL.

FIG. 9. The association between CBP and p/CIP is decreased in CARM1⫺/⫺ MEFs. (A) Whole-cell extracts were prepared from CARM1⫹/⫹ MEFs or CARM1⫺/⫺ MEFs (at a similar passage number). Approximately 20 ␮g of protein from each extract was separated by SDS-PAGE, and Western blotting was performed using anti-p/CIP antibody or antitubulin as a control. (B) Whole-cell extracts were prepared from CARM1⫺/⫺ MEFs or CARM1⫹/⫹ MEFs, and the amount of starting material in the input was normalized so that each had approximately the same amount of p/CIP based on Western blotting. p/CIP was then immunopurified by passing the protein extracts through an anti-p/CIP immunoaffinity column. After extensive washing, the bound proteins were eluted using 100 mM glycine (pH 3.0). Fractions were collected and assayed for p/CIP or CBP by SDS-PAGE followed by Western blotting.

hanced the transcriptional response of the carboxy terminus when tethered to Gal4. Under these experimental conditions, however, we did not observe a significant difference in the expression levels of the various fusion proteins. This suggested that in addition to its role in protein stability, methylation may promote a conformational change that weakens the association of accessory proteins such as CBP/p300 and consequently contributes to complex dissociation. In support of this hypothesis, we observed that CBP forms a stable association with p/CIP and copurified with p/CIP from extracts derived from CARM1⫺/⫺ MEFs, compared to CARM⫹/⫹ MEFs where no CBP was detected by Western blotting. Interestingly, a recent study has shown that CARM1-dependent methylation of the GRIP1-binding domain within CBP may also promote coactivator complex disassembly (31). Alternatively, methylation may result in a conformational change in p/CIP which allows another protein to bind, thereby preventing interaction with CBP/p300. The increase in p/CIP turnover and dissociation of CBP in response to methylation by another transcriptional coactivator seem paradoxical as these activities would typically be associated with the negative control of transcription. How-

MOL. CELL. BIOL.

ever, they are consistent with the notion that transcriptional activation by nuclear hormone receptors is a dynamic process involving repetitive cycles of association and dissociation of receptors and a large number of coregulators with target genes (38, 39). A number of mechanisms may contribute to this process, such as interaction with molecular chaperones which can associate with liganded nuclear receptors and disassemble nuclear receptor/coregulator complexes (14). In addition, several studies have established a link between ligand-dependent transcriptional activation by nuclear hormone receptors and the ubiquitin-proteasome pathway (25). For example, it has been shown that the degradation of ER␣, in response to ␤-estradiol, is dependent on the presence of AIB1 (48). Coactivator turnover is also dependent on interactions with the proteasome and may be directly regulated by phosphorylation. The phosphorylation of GRIP1 by protein kinase A induces its degradation via the ubiquitin-proteasome pathway, and a recent study has shown that SRC-3 is phosphorylated and then degraded in response to retinoic acid (16, 21). Interestingly, Li et al. have identified a novel interaction between the carboxy terminus of SRC-3 and Reg␥, an activator of the 20S proteasome. Loss of Reg␥ results in the accumulation of SRC-3 protein levels (33). Studies examining promoter occupancy have also established a link between proteasomal activity and transcriptional activation (25). It has been shown that recruitment of the proteasomal machinery is required for gene activation, presumably to allow cyclic clearance and continuous recycling of NR and coregulators at target genes (46, 48). The exact mechanism for coordinating the events involved in coactivator association and dissociation are poorly understood although increasing evidence suggests that posttranslational modifications may be instrumental to the overall process. For example, treatment of cells with hormones or various growth factors stimulates the phosphorylation of p/CIP/SRC-3 at specific sites and appears to be a prerequisite for hormone-dependent transcription activation that facilitates binding to CBP (13, 60). Acetylation of SRC-3 also appears to play a role in influencing transcription by facilitating coactivator release from hormone-bound NR (9). The human homologue of p/CIP was first isolated from human breast tumors, and it is located within a region of chromosome 20 that is often amplified in breast and ovarian cancer (2). Several follow-up studies have confirmed that p/CIP is amplified in a fraction of breast tumors, with amplification frequencies ranging from 5 to 10% (18, 35, 40, 45). Moreover, compared to normal breast epithelium, p/CIP is overexpressed at the RNA level in 31 to 64% of breast tumors examined. One question arising from the present study is whether deregulated arginine methylation of p/CIP plays a role in cellular transformation. Based on the data presented, we would predict that the methylation status of p/CIP is an important determinant of p/CIP transcriptional activity and may affect its oncogenic capacity. Alternatively, the accumulation of hypomethylated p/CIP could also adversely affect the cycling process inherent in NR-mediated transcription and impair transcription at selective promoters. In summary, the findings presented in this study link CARM1-dependent methylation of p/CIP to both protein turn-

VOL. 27, 2007


over and coactivator complex dissociation, establishing arginine methylation as a critical regulatory signal in p/CIP-mediated transcription. In addition, this type of regulation could serve to integrate diverse signaling pathways at the level of coactivator proteins and may have important implications for understanding the role of p/CIP in breast cancer. Further delineation of the role of p/CIP methylation and its downstream physiological effects is essential to decipher the complex regulatory circuits in nuclear receptor signaling. ACKNOWLEDGMENTS We thank M. Stallcup for the CARM1 cDNA and H. Herschman for the PRMTI cDNA. J.T. is supported by National Cancer Institute of Canada grant 015428. M.T.B. is supported by NIH grant DK62248 and in part by an institutional center grant (ES07784). REFERENCES 1. Anafi, M., Y. F. Yang, N. A. Barlev, M. V. Govindan, S. L. Berger, T. R. Butt, and P. G. Walfish. 2000. GCN5 and ADA adaptor proteins regulate triiodothyronine/GRIP1 and SRC-1 coactivator-dependent gene activation by the human thyroid hormone receptor. Mol. Endocrinol. 14:718–732. 2. Anzick, S. L., J. Kononen, R. L. Walker, D. O. Azorsa, M. M. Tanner, X. Y. Guan, G. Sauter, O. P. Kallioniemi, J. M. Trent, and P. S. Meltzer. 1997. AIB1, a steroid receptor coactivator amplified in breast and ovarian cancer. Science 277:965–968. 3. Bedford, M. T., and S. Richard. 2005. Arginine methylation an emerging regulator of protein function. Mol. Cell 18:263–272. 4. Beischlag, T. V., S. Wang, D. W. Rose, J. Torchia, S. Reisz-Porszasz, K. Muhammad, W. E. Nelson, M. R. Probst, M. G. Rosenfeld, and O. Hankinson. 2002. Recruitment of the NCoA/SRC-1/p160 family of transcriptional coactivators by the aryl hydrocarbon receptor/aryl hydrocarbon receptor nuclear translocator complex. Mol. Cell. Biol. 22:4319–4333. 5. Brown, K., Y. Chen, T. M. Underhill, J. S. Mymyrk, and J. Torchia. 2003. The coactivator p/CIP/SRC-3 facilitates retinoic acid receptor signalling via recruitment of GCN5. J. Biol. Chem. 278:39402–39412. 6. Chen, D., S. M. Huang, and M. R. Stallcup. 2000. Synergistic, p160 coactivator-dependent enhancement of estrogen receptor function by CARM1 and p300. J. Biol. Chem. 275:40810–40816. 7. Chen, D., H. Ma, H. Hong, S. S. Koh, S. M. Huang, B. T. Schurter, D. W. Aswad, and M. R. Stallcup. 1999. Regulation of transcription by a protein methyltransferase. Science 284:2174–2177. 8. Chen, H., R. J. Lin, R. L. Schiltz, D. Chakravarti, A. Nash, L. Nagy, M. L. Privalsky, Y. Nakatani, and R. M. Evans. 1997. Nuclear receptor coactivator ACTR is a novel histone acetyltransferase and forms a multimeric activation complex with P/CAF and CBP/p300. Cell 90:569–580. 9. Chen, H., R. J. Lin, W. Xie, D. Wilpitz, and R. M. Evans. 1999. Regulation of hormone-induced histone hyperacetylation and gene activation via acetylation of an acetylase. Cell 98:675–686. 10. Chevillard-Briet, M., D. Trouche, and L. Vandel. 2002. Control of CBP co-activating activity by arginine methylation. EMBO J. 21:5457–5466. 11. Daujat, S., U. M. Bauer, V. Shah, B. Turner, S. Berger, and T. Kouzarides. 2002. Crosstalk between CARM1 methylation and CBP acetylation on histone H3. Curr. Biol. 12:2090–2097. 12. Espejo, A., J. Cote, A. Bednarek, S. Richard, and M. T. Bedford. 2002. A protein-domain microarray identifies novel protein-protein interactions. Biochem. J. 367:697–702. 13. Font de Mora, J., and M. Brown. 2000. AIB1 is a conduit for kinasemediated growth factor signaling to the estrogen receptor. Mol. Cell. Biol. 20:5041–5047. 14. Freeman, B. C., and K. R. Yamamoto. 2002. Disassembly of transcriptional regulatory complexes by molecular chaperones. Science 296:2232–2235. 15. Fujiwara, T., Y. Mori, D. L. Chu, Y. Koyama, S. Miyata, H. Tanaka, K. Yachi, T. Kubo, H. Yoshikawa, and M. Tohyama. 2006. CARM1 regulates proliferation of PC12 cells by methylating HuD. Mol. Cell. Biol. 26:2273– 2285. 16. Gianni, M., E. Parrella, I. Raska, Jr., E. Gaillard, E. A. Nigro, C. Gaudon, E. Garattini, and C. Rochette-Egly. 2006. P38MAPK-dependent phosphorylation and degradation of SRC-3/AIB1 and RAR␣-mediated transcription. EMBO J. 25:739–751. 17. Gill, R. K., L. M. Atkins, B. W. Hollis, and N. H. Bell. 1998. Mapping the domains of the interaction of the vitamin D receptor and steroid receptor coactivator-1. Mol. Endocrinol. 12:57–65. 18. Glaeser, M., T. Floetotto, B. Hanstein, M. W. Beckmann, and D. Niederacher. 2001. Gene amplification and expression of the steroid receptor coactivator SRC3 (AIB1) in sporadic breast and endometrial carcinomas. Horm. Metab. Res. 33:121–126.

133

19. Harlow, E., and D. Lane. 1999. Using antibodies: a laboratory manual. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY. 20. Heery, D. M., E. Kalkhoven, S. Hoare, and M. G. Parker. 1997. A signature motif in transcriptional co-activators mediates binding to nuclear receptors. Nature 387:733–736. 21. Hoang, T., I. S. Fenne, C. Cook, B. Borud, M. Bakke, E. A. Lien, and G. Mellgren. 2004. cAMP-dependent protein kinase regulates ubiquitin-proteasome-mediated degradation and subcellular localization of the nuclear receptor coactivator GRIP1. J. Biol. Chem. 279:49120–49130. 22. Hong, H., K. Kohli, A. Trivedi, D. L. Johnson, and M. R. Stallcup. 1996. GRIP1, a novel mouse protein that serves as a transcriptional coactivator in yeast for the hormone binding domains of steroid receptors. Proc. Natl. Acad. Sci. USA 93:4948–4952. 23. Kamei, Y., L. Xu, T. Heinzel, J. Torchia, R. Kurokawa, B. Gloss, S. C. Lin, R. A. Heyman, D. W. Rose, C. K. Glass, and M. G. Rosenfeld. 1996. A CBP integrator complex mediates transcriptional activation and AP-1 inhibition by nuclear receptors. Cell 85:403–414. 24. Kim, J. H., H. Li, and M. R. Stallcup. 2003. CoCoA, a nuclear receptor coactivator which acts through an N-terminal activation domain of p160 coactivators. Mol. Cell 12:1537–1549. 25. Kinyamu, H. K., J. Chen, and T. K. Archer. 2005. Linking the ubiquitinproteasome pathway to chromatin remodeling/modification by nuclear receptors. J. Mol. Endocrinol. 34:281–297. 26. Koh, S. S., D. Chen, Y. H. Lee, and M. R. Stallcup. 2001. Synergistic enhancement of nuclear receptor function by p160 coactivators and two coactivators with protein methyltransferase activities. J. Biol. Chem. 276: 1089–1098. 27. Korzus, E., J. Torchia, D. W. Rose, L. Xu, R. Kurokawa, E. M. McInerney, T. M. Mullen, C. K. Glass, and M. G. Rosenfeld. 1998. Transcription factorspecific requirements for coactivators and their acetyltransferase functions. Science 279:703–707. 28. Lee, D. Y., C. Teyssier, B. D. Strahl, and M. R. Stallcup. 2005. Role of protein methylation in regulation of transcription. Endocr. Rev. 26:147–170. 29. Lee, J., and M. T. Bedford. 2002. PABP1 identified as an arginine methyltransferase substrate using high-density protein arrays. EMBO Rep. 3:268– 273. 30. Lee, S. K., H. J. Kim, J. W. Kim, and J. W. Lee. 1999. Steroid receptor coactivator-1 and its family members differentially regulate transactivation by the tumor suppressor protein p53. Mol. Endocrinol. 13:1924–1933. 31. Lee, Y. H., S. A. Coonrod, W. L. Kraus, M. A. Jelinek, and M. R. Stallcup. 2005. Regulation of coactivator complex assembly and function by protein arginine methylation and demethylimination. Proc. Natl. Acad. Sci. USA 102:3611–3616. 32. Li, H., P. J. Gomes, and J. D. Chen. 1997. RAC3, a steroid/nuclear receptorassociated coactivator that is related to SRC-1 and TIF2. Proc. Natl. Acad. Sci. USA 94:8479–8484. 33. Li, X., D. M. Lonard, S. Y. Jung, A. Malovannaya, Q. Feng, J. Qin, S. Y. Tsai, M. J. Tsai, and B. W. O’Malley. 2006. The SRC-3/AIB1 coactivator is degraded in a ubiquitin- and ATP-independent manner by the REG␥ proteasome. Cell 124:381–392. 34. Liao, L., S. Q. Kuang, Y. Yuan, S. M. Gonzalez, B. W. O’Malley, and J. Xu. 2002. Molecular structure and biological function of the cancer-amplified nuclear receptor coactivator SRC-3/AIB1. J. Steroid Biochem. Mol. Biol. 83:3–14. 35. List, A., K. Lauritson, R. Rieter, C. Powers, A. Wellstien, and A. Riegel. 2001. Ribozyme targeting demonstrates that the nuclear receptor coactivator AIB1 is a rate-limiting factor for estrogen-dependent growth of human MCF-7 breast cancer cells. J. Biol. Chem. 276:23763–23768. 36. Liu, Q., and G. Dreyfuss. 1995. In vivo and in vitro arginine methylation of RNA-binding proteins. Mol. Cell. Biol. 15:2800–2808. 37. McInerney, E. M., D. W. Rose, S. E. Flynn, S. Westin, T. M. Mullen, A. Krones, J. Inostroza, J. Torchia, R. T. Nolte, N. Assa-Munt, M. V. Milburn, C. K. Glass, and M. G. Rosenfeld. 1998. Determinants of coactivator LXXLL motif specificity in nuclear receptor transcriptional activation. Genes Dev. 12:3357–3368. 38. Metivier, R., G. Penot, M. R. Hubner, G. Reid, H. Brand, M. Kos, and F. Gannon. 2003. Estrogen receptor-alpha directs ordered, cyclical, and combinatorial recruitment of cofactors on a natural target promoter. Cell 115: 751–763. 39. Metivier, R., G. Reid, and F. Gannon. 2006. Transcription in four dimensions: nuclear receptor-directed initiation of gene expression. EMBO Rep. 7:161–167. 40. Murphy, L. C., S. L. Simon, A. Parkes, E. Leygue, H. Dotzlaw, L. Snell, S. Troup, A. Adeyinka, and P. H. Watson. 2000. Altered expression of estrogen receptor coregulators during human breast tumorigenesis. Cancer Res. 60: 6266–6271. 41. Onate, S. A., V. Boonyaratanakornkit, T. E. Spencer, S. Y. Tsai, M. J. Tsai, D. P. Edwards, and B. W. O’Malley. 1998. The steroid receptor coactivator-1 contains multiple receptor interacting and activation domains that cooperatively enhance the activation function 1 (AF1) and AF2 domains of steroid receptors. J. Biol. Chem. 273:12101–12108.

134

NAEEM ET AL.

42. Perissi, V., and M. G. Rosenfeld. 2005. Controlling nuclear receptors: the circular logic of cofactor cycles. Nat. Rev. Mol. Cell. Biol. 6:542–554. 43. Qi, C., J. Chang, Y. Zhu, A. V. Yeldandi, S. M. Rao, and Y. J. Zhu. 2002. Identification of protein arginine methyltransferase 2 as a coactivator for estrogen receptor alpha. J. Biol. Chem. 277:28624–28630. 44. Qutob, M. S., R. N. Bhattacharjee, E. Pollari, S. P. Yee, and J. Torchia. 2002. Microtubule-dependent subcellular redistribution of the transcriptional coactivator p/CIP. Mol. Cell. Biol. 22:6611–6626. 45. Rebbeck, T. R., Y. Wang, P. W. Kantoff, K. Krithivas, S. L. Neuhausen, A. K. Godwin, M. B. Daly, S. A. Narod, J. S. Brunet, D. Vesprini, J. E. Garber, H. T. Lynch, B. L. Weber, and M. Brown. 2001. Modification of BRCA1- and BRCA2-associated breast cancer risk by AIB1 genotype and reproductive history. Cancer Res. 61:5420–5424. 46. Reid, G., M. R. Hubner, R. Metivier, H. Brand, S. Denger, D. Manu, J. Beaudouin, J. Ellenberg, and F. Gannon. 2003. Cyclic, proteasome-mediated turnover of unliganded and liganded ER␣ on responsive promoters is an integral feature of estrogen signaling. Mol. Cell 11:695–707. 47. Shang, Y., X. Hu, J. DiRenzo, M. A. Lazar, and M. Brown. 2000. Cofactor dynamics and sufficiency in estrogen receptor-regulated transcription. Cell 103:843–852. 48. Shao, W., E. K. Keeton, D. P. McDonnell, and M. Brown. 2004. Coactivator AIB1 links estrogen receptor transcriptional activity and stability. Proc. Natl. Acad. Sci. USA 101:11599–11604. 49. Shi, Y., F. Lan, C. Matson, P. Mulligan, J. R. Whetstine, P. A. Cole, and R. A. Casero. 2004. Histone demethylation mediated by the nuclear amine oxidase homolog LSD1. Cell 119:941–953. 50. Strahl, B. D., S. D. Briggs, C. J. Brame, J. A. Caldwell, S. S. Koh, H. Ma, R. G. Cook, J. Shabanowitz, D. F. Hunt, M. R. Stallcup, and C. D. Allis. 2001. Methylation of histone H4 at arginine 3 occurs in vivo and is mediated by the nuclear receptor coactivator PRMT1. Curr. Biol. 11:996–1000. 51. Suen, C. S., T. J. Berrodin, R. Mastroeni, B. J. Cheskis, C. R. Lyttle, and D. E. Frail. 1998. A transcriptional coactivator, steroid receptor coactivator-3, selectively augments steroid receptor transcriptional activity. J. Biol. Chem. 273:27645–27653. 52. Tilli, M. T., R. Reiter, A. S. Oh, R. T. Henke, K. McDonnell, G. I. Gallicano, P. A. Furth, and A. T. Riegel. 2005. Overexpression of an N-terminally truncated isoform of the nuclear receptor coactivator amplified in breast cancer 1 leads to altered proliferation of mammary epithelial cells in transgenic mice. Mol. Endocrinol. 19:644–656. 53. Torchia, J., D. W. Rose, J. Inostroza, Y. Kamei, S. Westin, C. K. Glass, and M. G. Rosenfeld. 1997. The transcriptional co-activator p/CIP binds CBP and mediates nuclear-receptor function. Nature 387:677–684. 54. Torres-Arzayus, M. I., J. Font de Mora, J. Yuan, F. Vazquez, R. Bronson, M. Rue, W. R. Sellers, and M. Brown. 2004. High tumor incidence and activation of the PI3K/AKT pathway in transgenic mice define AIB1 as an oncogene. Cancer Cell 6:263–274.

MOL. CELL. BIOL. 55. Voegel, J. J., M. J. Heine, M. Tini, V. Vivat, P. Chambon, and H. Gronemeyer. 1998. The coactivator TIF2 contains three nuclear receptor-binding motifs and mediates transactivation through CBP binding-dependent and -independent pathways. EMBO J. 17:507–519. 56. Voegel, J. J., M. J. Heine, C. Zechel, P. Chambon, and H. Gronemeyer. 1996. TIF2, a 160-kDa transcriptional mediator for the ligand-dependent activation function AF-2 of nuclear receptors. EMBO J. 15:3667–3675. 57. Wang, H., Z. Q. Huang, L. Xia, Q. Feng, H. Erdjument-Bromage, B. D. Strahl, S. D. Briggs, C. D. Allis, J. Wong, P. Tempst, and Y. Zhang. 2001. Methylation of histone H4 at arginine 3 facilitating transcriptional activation by nuclear hormone receptor. Science 293:853–857. 58. Wang, Y., J. Wysocka, J. Sayegh, Y. H. Lee, J. R. Perlin, L. Leonelli, L. S. Sonbuchner, C. H. McDonald, R. G. Cook, Y. Dou, R. G. Roeder, S. Clarke, M. R. Stallcup, C. D. Allis, and S. A. Coonrod. 2004. Human PAD4 regulates histone arginine methylation levels via demethylimination. Science 306:279– 283. 59. Wu, R. C., J. Qin, Y. Hashimoto, J. Wong, J. Xu, S. Y. Tsai, M. J. Tsai, and B. W. O’Malley. 2002. Regulation of SRC-3 (pCIP/ACTR/AIB-1/RAC-3/ TRAM-1) coactivator activity by I␬B kinase. Mol. Cell. Biol. 22:3549–3561. 60. Wu, R. C., J. Qin, P. Yi, J. Wong, S. Y. Tsai, M. J. Tsai, and B. W. O’Malley. 2004. Selective phosphorylations of the SRC-3/AIB1 coactivator integrate genomic responses to multiple cellular signaling pathways. Mol. Cell 15:937– 949. 61. Xu, J., L. Liao, G. Ning, H. Yoshida-Komiya, C. Deng, and B. W. O’Malley. 2000. The steroid receptor coactivator SRC-3 (p/CIP/RAC3/AIB1/ACTR/ TRAM-1) is required for normal growth, puberty, female reproductive function, and mammary gland development. Proc. Natl. Acad. Sci. USA 97:6379– 6384. 62. Xu, W., H. Chen, K. Du, H. Asahara, M. Tini, B. M. Emerson, M. Montminy, and R. M. Evans. 2001. A transcriptional switch mediated by cofactor methylation. Science 294:2507–2511. 63. Xu, W., H. Cho, S. Kadam, E. M. Banayo, S. Anderson, J. R. Yates, 3rd, B. M. Emerson, and R. M. Evans. 2004. A methylation-mediator complex in hormone signaling. Genes Dev. 18:144–156. 64. Yadav, N., J. Lee, J. Kim, J. Shen, M. C. Hu, C. M. Aldaz, and M. T. Bedford. 2003. Specific protein methylation defects and gene expression perturbations in coactivator-associated arginine methyltransferase 1-deficient mice. Proc. Natl. Acad. Sci. USA 100:6464–6468. 65. Zhou, G., Y. Hashimoto, I. Kwak, S. Y. Tsai, and M. J. Tsai. 2003. Role of the steroid receptor coactivator SRC-3 in cell growth. Mol. Cell. Biol. 23: 7742–7755. 66. Zhou, H. J., J. Yan, W. Luo, G. Ayala, S. H. Lin, H. Erdem, M. Ittmann, S. Y. Tsai, and M. J. Tsai. 2005. SRC-3 is required for prostate cancer cell proliferation and survival. Cancer Res. 65:7976–7983.